KEGG   Scheffersomyces stipitis: PICST_88710Help
Entry
PICST_88710       CDS       T01023                                 

Gene name
GLC3
Definition
(RefSeq) alpha-1,4-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pic  Scheffersomyces stipitis
Pathway
pic00500  Starch and sucrose metabolism
pic01100  Metabolic pathways
pic01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PICST_88710 (GLC3)
Enzymes [BR:pic01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PICST_88710 (GLC3)
Exosome [BR:pic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PICST_88710 (GLC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase CBM_48 Glyco_hydro_66
Motif
Other DBs
NCBI-GeneID: 4837935
NCBI-ProteinID: XP_001383281
JGI: 88710
UniProt: A3LQS2
Position
3
AA seq 701 aa AA seqDB search
MSTDNKSLIKGALDVDPWLEPYSQPLIDRQLKFQKWYADLKSSETSLFQFASSYQTYGVH
GNWDTKEVVVTQYVPDIQEVSLVGEFNNWDVSAHKLKKVNNFGLWSLTIPPVDGDFAIKH
DSKYKISMKLPSGEQIYRLDPWLRRATPATETTLYEGRFWNPSPAETYKFKNKRATFNST
EGIRIYEAHIGISTPEPTVGSYKNFTENILPIIHKSGYNTIQLMAVMEHAYYASFGYQVT
NFFAISSRFGTPEELKELIDTAHGLGIKVLLDVVHSHSSKNVEDGLNMFNGTDHYLFHGG
PKGNHDLWDSRLFNYENHETLRFLLSNLKFFIDVYQFDGFRFDGVTSMMYKHHGLSFGFS
GDYNEYFNPEWVDTDAVVYLMLAHQLLSEISEKEDGFKFFSIAEDVSGMPTLCLTIPEGG
IGFDYRLSMAIPDMWIKILKHLSDEQWDLHSIVHTLTNRRYKEKCIAYCESHDQALVGDK
TIAFWLMDKEMYTHMSVLSPLTPIIDRGLSLHKLIRLLTFGLGGEGYLNFEGNEFGHPEW
LDFPRVGNNESYHYARRQFNLIKDDLLRYKFLYAFDAGMLSLDSKYGVLDKPQAYVSLKH
EGDKVLVFERNGLLFVFNFHHSQSFPDYKIGVETAGTYQIVLNSDEAQYGGHDRIQEVDA
NGKPVQYFTNNDPWNNRSNSMMVYIPSRTAIVLQLKDKIKA
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgtctacagacaacaaactgctcatcaaaggtgccctcgacgtcgatccatggttggaa
ccttactcgcagccacttatcgaccgtcagcttaagttccaaaaatggtacgctgacttg
aagctgctggaaacttctcttttccaattcgcttcgtcgtaccagacctatggtgtccac
ggtaactgggacaccaaggaagtggtggtgactcaatacgttcccgatatccaggaggtc
tctttggtaggagaattcaataattgggatgtttctgctcacaaattgaagaaagtcaac
aattttggcttgtggtcacttaccattcctccagtcgatggagattttgcaatcaaacat
gattccaagtacaagatctcgatgaaattgccctcaggcgaacagatttaccgtttggat
ccgtggttgagaagagctacccctgccacagaaaccactttgtacgaaggccgtttctgg
aacccttcgccagctgaaacctacaagttcaagaacaagagagcaaccttcaactccact
gagggtatcagaatctacgaagcccacatcggtatctcgactccagaacccaccgttggt
tcctacaagaactttacggaaaacattttgcccatcatccacaagctgggctacaacacc
atccagttgatggcagtcatggaacacgcctactacgcttcctttggctaccaggtcacc
aacttctttgctatttcgtctcgttttggaactccagaggaattgaaagagttgatcgat
acagcacacggccttggaatcaaggtgttgttggatgttgttcattcgcattcgtctaag
aacgtcgaagatggtttgaacatgttcaatggaacagaccactacttgttccacggcgga
cccaagggtaaccatgatttgtgggactccaggttgttcaattacgaaaaccacgagaca
ttgagattcctcttgtccaatttaaagttctttatcgacgtctatcagtttgacgggttc
agattcgacggagtcacctccatgatgtacaaacaccacggattaagtttcggattctcg
ggtgactacaatgagtacttcaaccctgaatgggttgatacagatgccgtggtttacttg
atgcttgcccatcagttattgctggagatcagcgagaaagaagacggcttcaagttcttc
tccattgccgaagatgtctcgggtatgcctactctttgtttgactattcctgaaggtggt
attggatttgactacagattgtccatggccattcccgacatgtggatcaagattttgaaa
cacttgtcggacgaacaatgggatctccattctatcgtccataccttgacaaacagaaga
tataaagaaaagtgtattgcttactgcgagtctcacgatcaagctttggtcggcgacaag
accattgcattctggctcatggacaaggaaatgtacacgcacatgtcagttctttctcca
ctcactccaatcatcgacagaggtctttccttacacaaattgattcgtttgcttactttt
ggtttaggaggtgaagggtacttaaactttgaaggtaatgaattcggccatcctgagtgg
ttagatttccccagggttggaaacaacgagtcgtaccactatgccagaagacagttcaac
cttattaaggacgacttgttgcgttacaagttcttgtatgcatttgacgctggaatgctc
tcgttagacagcaagtatggtgtcttggacaaaccccaggcttatgtctcattgaagcac
gaaggtgacaaggtccttgtttttgaaagaaatggccttctctttgtgttcaacttccac
cacagccagtccttcccagactacaagattggtgttgaaactgctggtacctaccagatt
gttttgaactctgacgaagcgcaatatggtggtcacgacagaatccaagaagtcgatgcc
aacggcaagcctgttcagtatttcaccaacaatgatccatggaacaacagatcgaattcg
atgatggtatacattccaagcagaactgctattgtcttgcaacttaaagacaagatcaaa
gcttaa

DBGET integrated database retrieval system