KEGG   Scheffersomyces stipitis: PICST_89873Help
Entry
PICST_89873       CDS       T01023                                 

Gene name
ACS1
Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pic  Scheffersomyces stipitis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PICST_89873 (ACS1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PICST_89873 (ACS1)
   00620 Pyruvate metabolism
    PICST_89873 (ACS1)
   00640 Propanoate metabolism
    PICST_89873 (ACS1)
  Energy metabolism
   00680 Methane metabolism
    PICST_89873 (ACS1)
Enzymes [BR:pic01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PICST_89873 (ACS1)
Lipid biosynthesis proteins [BR:pic01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PICST_89873 (ACS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 675 aa AA seqDB search
MPESTQQSHLTLDHEKKMDPPQGFFERSKSKPNLPDFDTYKKMYDQSVTDPNTFFGEQAK
NSLDWFKPFDLARFPVDSKDDFKNGDLPAWFINGQLNACYNAVDRWAIKNPNKPAIIYEG
DEPNTGRIISYGELLKQVSKLAQSLTKLGVKKGDSVAVYLPMIPEAIVTLLAIVRIGAIH
SVVFAGFSSTSLKDRILDGDSQIVITADESKRGGKTIETKKIVDDALKDCPNVRNVIVFK
RTGNAHVPFNPKRDLWWHEELDKYGPYFPPVPVNSEDPLFLLYTSGSTGKPKGVQHNTAG
YLLGALLTTKYTFDVHEDDIIFTAGDIGWITGHTYVVYGPLLNGATTVVFEGTPAYPNFS
RYWDIVDEYKVNQFYVAPTALRLLKRAGTKFVENYDLSSLRVLGSVGEPIAAEVWHWYND
NIGRGKAHIVDTYWQTESGSHLLTPLAGVTPTKPGSASLPFFGIVPKILDPTTGAELNEN
DVEGVLAIKSAWPSITRGIFNDYNRFIDTYLKPYPNHYFSGDGAARDNDGFYWILGRVDD
VVNVSGHRLSTAEIEAALIEHHLVAESAVVGYADDLTGQAVAAYVSLKKDKNIEDDIEAV
KKELILTVRKEIGPFAAPKLILLVDDLPKTRSGKIMRRILRKVLAGEADQLGDISTLSNP
GVVKQIIDVVNSSKK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaatctactcaacaatcccacctcaccttggaccacgagaagaagatggaccct
ccacagggtttcttcgagaggtccaagtccaagcctaacttgccagactttgacacctac
aagaagatgtacgaccagtccgttaccgatccaaataccttcttcggtgaacaagccaag
aacagcttggattggttcaaaccttttgacttggcaagatttcctgtcgattccaaggac
gacttcaaaaacggtgacttgccagcttggttcatcaacggtcagttgaatgcctgttac
aatgctgttgaccgttgggccatcaagaaccccaacaagcctgctatcatctatgaagga
gatgaaccaaacaccggcagaatcatctcttacggtgaattattgaaacaggtatcgaag
ttggcacagtctttgacaaagttgggagtcaagaagggagactctgttgccgtctattta
ccaatgattcctgaagccatcgttacattgttggctatcgtgagaattggagctatccac
tcggtagttttcgcaggtttctcgtcgacatcacttaaggacagaatcttggatggtgac
tctcaaatcgtcatcactgctgacgagtctaagagaggtggaaagactattgaaaccaag
aaaattgtcgacgacgccttgaaggactgtccaaatgtcagaaacgtcattgtcttcaag
agaactggtaacgctcacgtacctttcaatcctaagagagatttgtggtggcacgaagaa
ttggacaaatatggtccatacttcccacctgttccagtcaactctgaagacccattgttc
ttgttatatacctcgggttctactggaaagccaaagggtgttcagcacaacaccgctggt
tacttgttgggcgctcttttgaccaccaagtatacttttgatgtccacgaagatgatatt
atctttactgcaggtgatatcggctggattaccgggcatacgtatgtcgtatacggtcct
cttttgaatggtgccaccaccgttgtttttgaaggaactccagcctatcctaacttctcg
agatactgggatatcgttgacgagtacaaagttaaccagttctatgtcgcccctactgcc
cttagattgttgaagagagccggcactaagtttgttgagaactacgacttgtcttcgctc
agagttcttggatccgtcggtgaacctattgctgctgaagtctggcattggtacaacgac
aacatcggcagaggcaaggcacacattgtcgatacctactggcaaaccgagtcgggatca
catttgttaactcctttggccggtgtgactcctacgaagcctggttctgcttctttacca
ttctttggtattgttcccaagatcttggatcctaccactggtgccgaattgaatgagaac
gacgtcgaaggtgttttggcaatcaaatctgcctggccatcgatcaccagaggtatcttc
aacgactacaacagatttatcgacacctacttgaaaccataccctaaccactacttttcc
ggagatggtgctgccagagataatgatggtttctactggatcttgggtagagttgatgat
gtggttaatgtatctggtcatagattatccactgccgaaattgaggctgctcttattgag
caccacttagtggctgaatcggccgttgtgggttatgctgacgacttgactggtcaagct
gtggctgcctacgtttccctcaagaaagacaagaacatcgaagacgacatcgaagccgtc
aagaaggaattgatcttgactgtcagaaaggaaattggtccttttgctgctcctaagttg
attttgttggttgatgacttaccaaagaccagatctggtaagatcatgagaagaatcttg
agaaaggttttggctggtgaagctgatcagttgggtgatatctcaactttgtcgaacccc
ggtgttgtcaaacagatcatcgatgttgtcaactcctcaaagaagtaa

DBGET integrated database retrieval system