KEGG   Scheffersomyces stipitis: PICST_90238Help
Entry
PICST_90238       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
pic  Scheffersomyces stipitis
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    PICST_90238
Enzymes [BR:pic01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     PICST_90238
Glycosyltransferases [BR:pic01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   PICST_90238
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 821 aa AA seqDB search
MAKKQSSAAKAAALKAKQAPSLLSVDPVVDPVFAQGAIRSYLVTDPAPTLLKKRSLLGSN
EWILIAVLLVASYYVRMYNLSYPKSVVFDEVHFGGFARKYILGKYFMDVHPPLAKMLFAA
VASYGGFKGDFEFKSIGDYFPEGTPYVLMRQFPALLGIGTVLLAYFTLRSSGVRPVIAFA
TSFLLLVENSNVTISRYILLDSPLLFFIAASIFAWKKFEIQTPFSAGWFKSLIATGVALG
LALSSKWVGLFTVAWVGLSCVYQMWFIVGDLSVSAKKVVAHAFFRGSILLGVPALLYLFF
FAVHFQVLSKEGDGSAFMSSAFRAGLEGNSIPKNIIAQVGLGSTVTIRHIDTQGGYLHSH
EHYYPAGSKQQQITLYPHLDSNNKWFIEPYSNLTVYNETFVPLTDGMKVRLKHINSGKRL
HSHDEKPPVSERDWQKEASCYGFEGFAGDANDDWVVEIVSHRTPEGEARNNVIALTSVIR
FRHAMSGHYLFSSEVKLPEWGFGQQEVSAASSGRRALTHWYIETNENPMLSQSEARIINY
PKLTLLQKFTESHKRMWKINQGLTDHHNWQSEPQEWPLMLRGINYWVREHRQVYLMGNAV
TWWTVSSVIAVFFLYTAIQAIRWHTGSQIATDKNVYNFNFQAFSYILGWGLHYLPFFIMG
RQLFLHHYLPALYFGILALGHFLELFTGYFLARSQFLQRFGLGLVTIFVALSAVFYINYS
PLIYATNWTKDQCKRSKAISTWDFDCNTFHGNISEYSIDEAASLTSASKIADDLLKKVEE
AHETPVAEPVQQVLKVEEPAAEDPVAEPVEEVVEVIDVSAQ
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaaacagtcctcggctgctaaagctgctgcgctcaaggccaaacaagctcct
tccctacttctggtggatccagtagtggatccggttttcgctcaaggtgctatccgctcg
tatctagtgaccgacccggctccaactttgcttaaaaagcgttctttgctcggttccaac
gaatggattcttatcgctgttctacttgtggcttcttactacgtgagaatgtacaacttg
tcgtatcccaaatctgtggtgtttgacgaagtacacttcggaggctttgccagaaagtat
attctcggtaaatacttcatggatgtgcacccaccgttggcaaagatgctttttgcagct
gttgcttcctacggaggcttcaagggtgattttgaattcaagagtattggtgactacttc
cctgaaggtacaccctatgttctcatgagacagttccccgcgttgttgggtatcggcacg
gtactcttagcgtacttcactttgcgtagttccggcgttagacctgtcattgcttttgct
accagttttcttttgttggtagagaactccaacgtaacaatcagtagatacattctcttg
gactctccacttcttttcttcattgctgcatccatttttgcctggaagaagttcgagatt
cagacccctttctccgctggctggttcaagagtttgattgctaccggtgttgctcttggt
ttagctcttagttccaagtgggtgggccttttcactgtagcttgggtaggtctctcctgc
gtgtatcagatgtggttcatcgttggtgacttgtccgtcagcgctaagaaggtcgttgcc
catgctttcttcaggggctccatcttgttgggtgtccctgccttgttgtacctcttcttc
tttgcagttcatttccaggtgttgagcaaggaaggtgatggttctgctttcatgtccagt
gccttcagagccggcttggaaggcaacagcattcccaagaatattattgctcaagtgggt
ttaggttcgactgtaacaattcgtcacatcgacactcaaggtggctatttgcactcgcac
gaacactactatcctgctggttccaaacagcaacagattacgttatacccccatttggac
tccaacaacaaatggttcatcgaaccatacagcaacctcactgtgtacaatgaaacgttt
gtgcctttgacagatggtatgaaggtaagattaaagcacatcaattcaggcaagagattg
cactctcacgatgaaaagcctcctgtcagtgaacgtgactggcagaaggaagcttcttgt
tacgggttcgaaggatttgccggtgacgccaatgacgactgggttgtagaaatcgtaagc
cacaggaccccagagggcgaagcccgcaataacgtgatcgccttaacatctgtaatcaga
ttcagacacgccatgtctggacactatttgttctcgtcggaagtcaaattgccagaatgg
ggttttggccaacaagaagtctctgctgcctcgtctggtagaagagcattgacccactgg
tatatcgagactaatgaaaatcctatgttgagccagagtgaagccaggatcatcaactat
cctaagttaacgttgttgcagaagttcactgagtcccacaagcgcatgtggaagatcaac
cagggcttaaccgatcaccataactggcagtctgaaccccaagaatggccattgatgttg
agaggtattaactactgggtcagagaacacagacaagtatatttgatgggtaatgccgtg
acctggtggactgtctcgtctgttattgctgttttcttcttgtacactgccattcaagct
atcagatggcacactggtagtcaaattgcgactgacaagaatgtttacaacttcaatttc
caagccttttcatacatattgggttggggtcttcattacctcccattcttcattatgggt
agacaattgttcttgcatcactacttgccagctctttactttggtatcttggctctcgga
cacttccttgaactttttactggttacttcttggcccgctcccaattcttacaaagattc
ggcttgggcttggtcaccatctttgttgctctcagcgctgttttctacatcaattactct
cctttgatttatgccaccaactggaccaaagaccagtgtaagagatctaaggccatcagt
acttgggactttgactgtaacaccttccacggaaacatcagcgagtacagcatcgacgaa
gctgctctgcttacaagtgctagcaagattgctgacgatcttctcaaaaaggtagaagaa
gctcacgagacgcctgtggctgaaccagttcaacaagtcctcaaggttgaagaaccggct
gctgaagacccagtagcagagccagtagaggaagttgtagaagttattgatgtttctgca
caatag

DBGET integrated database retrieval system