KEGG   Scheffersomyces stipitis: PICST_91065Help
Entry
PICST_91065       CDS       T01023                                 

Gene name
TRP6
Definition
Anthranilate synthase component II Includes: Glutamine amidotransferase Indole-3-glycerol phosphate synthase (PRAI)
Orthology
K01656  
anthranilate synthase / indole-3-glycerol phosphate synthase [EC:4.1.3.27 4.1.1.48]
Organism
pic  Scheffersomyces stipitis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PICST_91065 (TRP6)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PICST_91065 (TRP6)
Enzymes [BR:pic01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PICST_91065 (TRP6)
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     PICST_91065 (TRP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 512 aa AA seqDB search
MTKELPKRHVLIIDNYDSFTWNLYQYLYQSPLCGKVDVFRNDKIDISTIENQVKPDIILI
SPGPGHPTSDSGISRDVIKHFMGKLPIFGICMGQQCMIDAFGGEVTYAGEIVHGKTTTIK
HDGRGMFDTVPQSVAVTRYHSLAGTQQTLPDCLEVTALTETTPEIIMGVRHKIYTIEGVQ
FHPESILTESGQIMINNLLSVTGGTWDENKANGSGFSKKENILSKIYKQRQIDYKRIESL
PGKSLEQLEISLALNIAPPITDFYQRLKYTQDVLKQTIILSEFKRASPSKGDINIDAHPG
KQALTYATNGCSTISVLTEPKWFKGSLDDLSLIRKVIDIPTTEGYKRPAVLRKEFIFSKY
QILEARLAGADTVLLIVKMLNDIKLLQQLYEYSLSLGMIPLVEVQNKQELDQAVKLTYND
DTKEPLVIGVNNRNLATFDVDLNTTSSLVESSKKSQRRGDVLVLALSGITSVEDVKNYKY
NDGVDGFLIGESLMRAEERGEAGKFLNDLCNC
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagaattgcccaagagacatgtcttaattatagacaactacgactcgttcact
tggaacctctaccagtatttataccagtcaccattgtgtgggaaggtagacgttttcaga
aacgacaagatcgacatttctaccattgaaaatcaagtcaagcccgacattatcctcatt
tctccaggaccgggccatcctactagcgattcaggaatctctcgagacgtcatcaaacac
ttcatgggaaaacttcctatctttggcatctgtatgggtcagcaatgtatgattgatgcg
tttggtggagaagtgacttatgccggagaaattgtccacggcaagacaactaccattaaa
catgacggtagaggaatgtttgacaccgttccacaatcagttgctgtcacgaggtaccat
tcattggctggaacccaacagacattgccagactgtttggaagtcacagcactaaccgag
actactccagagatcattatgggagttagacacaagatttacacaattgaaggagttcag
ttccacccagaatccattttgaccgaatcgggccaaataatgatcaacaacttgttgtct
gtcacaggaggaacctgggacgagaacaaagccaacggatccggcttttcaaagaaggaa
aatattttgtccaagatctacaagcaacgtcaaattgactacaagagaattgagagcttg
ccaggaaaatcacttgagcaattggagatctcattggcattgaacattgctccacccata
acagacttctaccagagattgaagtacacccaggacgtgctcaagcaaaccatcattttg
tcagagttcaagcgtgcatctccgtctaagggagacatcaatattgatgcgcatccaggt
aaacaggcattgacatatgctaccaatggatgttccaccatatcggtgttgaccgaaccc
aagtggtttaagggttccttggatgacttgtcattgatccgtaaggttatcgatattcca
actactgaaggatacaagagaccagccgtattgagaaaagagttcattttcagcaagtac
cagatcttggaagctagattggcaggcgcagatactgtgctattaatagtgaagatgttg
aatgatatcaagttattacaacaactatacgaatactctttgtcgttgggtatgattccg
ttggttgaagttcaaaacaagcaagaattggaccaggcagtgaagttaacgtacaacgat
gacaccaaggagccattggtgatcggtgtcaacaacagaaacttagctacattcgacgtt
gatttgaataccaccagctctttggttgaatcttcaaagaaaagccaaagaaggggtgat
gttcttgtgttggcattatcgggaattacttccgttgaagacgttaagaactacaagtac
aacgacggagttgacggctttttgattggcgaaagtttgatgagagcagaagaaagggga
gaggcaggcaagttcttgaacgacttgtgcaattgctaa

DBGET integrated database retrieval system