KEGG   Scheffersomyces stipitis: PICST_91105Help
Entry
PICST_91105       CDS       T01023                                 

Gene name
TPI1
Definition
Triosephosphate isomerase (TIM) (Triose-phosphate isomerase)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pic  Scheffersomyces stipitis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PICST_91105 (TPI1)
   01230 Biosynthesis of amino acids
    PICST_91105 (TPI1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PICST_91105 (TPI1)
   00051 Fructose and mannose metabolism
    PICST_91105 (TPI1)
   00562 Inositol phosphate metabolism
    PICST_91105 (TPI1)
Enzymes [BR:pic01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PICST_91105 (TPI1)
Exosome [BR:pic04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PICST_91105 (TPI1)
  Exosomal proteins of bladder cancer cells
   PICST_91105 (TPI1)
  Exosomal proteins of melanoma cells
   PICST_91105 (TPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 248 aa AA seqDB search
MARQFFVGGNFKMNGTKDSVTKIIDNLNSAELPTSVEVVIAPPAPYLALAVAENKQPTIA
VSSQNVFDKASGAYTGEISPAQVLDLGAKWTLTGHSERRTIIKESDEFIADKTKFALESG
LSVILCIGETLEERKAGITLDVCARQLDAVSKIVSDWSNIVVAYEPVWAIGTGLAATPQD
AQDTHKGIRDHLVKTIGAEQAAAVRILYGGSVNGKNAPEFKDKADVDGFLVGGASLKPEF
VDIIKSRL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtcaattcttcgttggtggtaacttcaagatgaacggtaccaaggactcggtc
accaagatcatcgacaacttgaactccgctgaattgcctacttccgtcgaagtggtcatc
gctcctcctgccccatacttggctttggctgttgctgaaaacaagcagcccaccattgct
gtctcttcccagaacgtctttgacaaggcttcaggtgcctacaccggagaaatctcgcca
gcccaggttttggacttgggtgccaaatggactttgaccggccactccgaaagaagaact
atcatcaaggagtctgacgaattcatcgccgacaagaccaagttcgccttggaatcaggc
ttgtcagttatcttgtgtatcggtgaaaccttggaagagcgtaaggctggtatcaccttg
gacgtttgtgctagacaattggacgctgtttccaagatcgtttccgactggtccaacatc
gtcgttgcctacgaaccagtgtgggctatcggtaccggtttggctgctactcctcaagat
gcccaagacacccacaagggtatcagagaccacttggtcaagaccatcggtgccgaacaa
gcagctgctgtgagaatcttgtacggaggctctgttaacggcaagaacgctccagagttc
aaggacaaagccgatgtcgatgggttcttagtcggtggtgcttcgttgaagccagagttt
gttgacatcatcaagtccagattgtag

DBGET integrated database retrieval system