KEGG   Phytophthora infestans: PITG_00124Help
Entry
PITG_00124        CDS       T01333                                 

Definition
(RefSeq) ser/thr kinase
Organism
pif  Phytophthora infestans
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
AA seq 319 aa AA seqDB search
MNNLENSFIAGAGAYVKGKYAITSTGVVRKGTGRAFSVVPEELEWGGQVIGRGASGCVLI
SRHRPTNTPLALKMINMYDKIKREQIIREINALFDAKCPCLVTFFGAFLRDGAVVLALEY
MDGGSLENVIHQLGTIPEHVLASMAFQILHALSYLKTNKRVHRDIKPPNILLNSQGQVKL
SDFGIASELGNSIAMCGTFVGTFRYMSPERIQHTQYSYSSDIWSLGLVLMEAATGVYPYP
KHKACIDMLQSVLEAPPPALSPQYFSQDFCDFLHQCLQKNPLDRASADALLESPWLQRCG
AVNLEKSIGNVRHWIDSLQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacctcgagaattccttcattgccggtgctggcgcctatgtcaaaggcaagtac
gctatcacatcgacaggggtcgtccgaaagggaacaggacgcgccttcagcgtcgtaccg
gaagagctggaatggggcggacaggtgatcggtcgaggcgccagcggctgtgtgctgatc
tcgcgtcaccgaccgaccaatacgccgttggcactcaagatgattaacatgtacgacaag
atcaaacgtgagcagataatccgtgagatcaacgcgctgttcgacgcaaagtgtccgtgt
ctcgtaactttcttcggcgcgttcctccgtgacggagccgtggtgctcgctctcgagtac
atggatggaggatcattagaaaacgtaatccatcagctcggtaccattccagaacacgtc
ctggctagcatggccttccagatcctccacgcgctgtcatatctcaagacaaacaagcgc
gttcaccgcgatatcaagccgcccaatattttacttaacagccagggtcaagtcaaactc
tcggactttggtatcgcttccgagctcggcaactcaatcgccatgtgcggtacgtttgta
ggcaccttccgctacatgtcgcctgagcgtatacaacacacgcagtacagctacagctcg
gacatctggagtctcggtctcgtgctcatggaggccgcaactggcgtgtacccgtaccca
aaacacaaggcttgcatcgacatgttgcagagtgtactggaagcaccgccgccagctctg
tcgccacagtatttttctcaggatttctgcgactttttacaccagtgtttgcaaaagaac
ccgctcgatcgtgcgtcagcggatgctctgcttgaatcaccttggctgcagcgctgcggg
gctgttaacctcgagaagtcgatcggtaatgtgcggcattggatcgactcgctgcaataa

DBGET integrated database retrieval system