KEGG   Phytophthora infestans: PITG_00124Help
Entry
PITG_00124        CDS       T01333                                 

Definition
ser/thr kinase
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     PITG_00124
Protein kinases [BR:pif01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   PITG_00124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 319 aa AA seqDB search
MNNLENSFIAGAGAYVKGKYAITSTGVVRKGTGRAFSVVPEELEWGGQVIGRGASGCVLI
SRHRPTNTPLALKMINMYDKIKREQIIREINALFDAKCPCLVTFFGAFLRDGAVVLALEY
MDGGSLENVIHQLGTIPEHVLASMAFQILHALSYLKTNKRVHRDIKPPNILLNSQGQVKL
SDFGIASELGNSIAMCGTFVGTFRYMSPERIQHTQYSYSSDIWSLGLVLMEAATGVYPYP
KHKACIDMLQSVLEAPPPALSPQYFSQDFCDFLHQCLQKNPLDRASADALLESPWLQRCG
AVNLEKSIGNVRHWIDSLQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacctcgagaattccttcattgccggtgctggcgcctatgtcaaaggcaagtac
gctatcacatcgacaggggtcgtccgaaagggaacaggacgcgccttcagcgtcgtaccg
gaagagctggaatggggcggacaggtgatcggtcgaggcgccagcggctgtgtgctgatc
tcgcgtcaccgaccgaccaatacgccgttggcactcaagatgattaacatgtacgacaag
atcaaacgtgagcagataatccgtgagatcaacgcgctgttcgacgcaaagtgtccgtgt
ctcgtaactttcttcggcgcgttcctccgtgacggagccgtggtgctcgctctcgagtac
atggatggaggatcattagaaaacgtaatccatcagctcggtaccattccagaacacgtc
ctggctagcatggccttccagatcctccacgcgctgtcatatctcaagacaaacaagcgc
gttcaccgcgatatcaagccgcccaatattttacttaacagccagggtcaagtcaaactc
tcggactttggtatcgcttccgagctcggcaactcaatcgccatgtgcggtacgtttgta
ggcaccttccgctacatgtcgcctgagcgtatacaacacacgcagtacagctacagctcg
gacatctggagtctcggtctcgtgctcatggaggccgcaactggcgtgtacccgtaccca
aaacacaaggcttgcatcgacatgttgcagagtgtactggaagcaccgccgccagctctg
tcgccacagtatttttctcaggatttctgcgactttttacaccagtgtttgcaaaagaac
ccgctcgatcgtgcgtcagcggatgctctgcttgaatcaccttggctgcagcgctgcggg
gctgttaacctcgagaagtcgatcggtaatgtgcggcattggatcgactcgctgcaataa

DBGET integrated database retrieval system