KEGG   Phytophthora infestans: PITG_00145Help
Entry
PITG_00145        CDS       T01333                                 

Definition
histone methyltransferase, putative
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
pif  Phytophthora infestans
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pif00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 236 aa AA seqDB search
MYSITRETVLTETSECAQSQEVKELSLEEFRRLMTYGEVSVESIASTVLPLFNLDADDVF
FDLGCGTGKILVQAALQTPCKRAIGIELMQNRVQEGQRALNRLKERDIAVLEDKEIEIFR
GDIFVPPEEARLMDATVVFINNVMFGPQLMLKVLQLLKEMPKLRCVMTLRKICERHGHEK
CSRAGNYCVEYVQPPVEQEIDVSWADKTSIYFYESLDFKLKQLTQELAKGGHRPMW
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtacagcatcaccagggagacggttctcacggagacgagcgagtgtgcgcaatctcaa
gaagttaaggagctgagcttagaggaatttcgacgactgatgacatacggtgaagtgtca
gttgagtccatcgcctccacggtcctgccattgtttaatttggacgcggacgacgtgttc
tttgatcttggctgtggcacgggaaagatcttggtccaagcagcgcttcaaacgccatgc
aaacgagcaataggcatcgagctgatgcagaatcgcgtccaggaaggacaaagggcgctg
aatcgactcaaagagcgtgatattgccgttctcgaagataaagaaatcgagatcttccga
ggcgacatctttgtccctcccgaggaagctcgcctcatggacgcgacggtggttttcatc
aacaacgtgatgttcggtcctcaactcatgctcaaggtgttgcagcttctcaaggagatg
cccaagctgcggtgtgtcatgacgctacgtaagatctgcgaacgtcacggtcacgaaaag
tgctcgcgtgctggcaactactgcgtcgagtacgtccagcctccagttgaacaagagatc
gacgtgtcctgggctgataaaacctccatctacttctacgaaagcctcgacttcaagctt
aagcagctcactcaagagttggctaaaggtggccaccgtcctatgtggtga

DBGET integrated database retrieval system