KEGG   Phytophthora infestans: PITG_00178Help
Entry
PITG_00178        CDS       T01333                                 

Definition
dual specificity tyrosine-phosphorylation-regulated kinase, putative
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PITG_00178
Protein kinases [BR:pif01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   PITG_00178
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 457 aa AA seqDB search
MEITDGAVATRRPLKDTPRHQLTRGLMRTLNVINVNYYRKHNPKPTGVLAKKKKKVPANY
IFSEAGEETFNNGRYVVRGRKLGAGSFGQVVEAQDLLTKQLVAIKVVQKKQQYTEQAQTE
ISILQLLHLPQQHDATNHIVRLTDTFMHQGHQCLVFDRLGPNLFDVLRGTNFFGISLKLL
RKFTRQILKALEYMRHPNVNVIHCDLKPENILLVSHGHSSLKLIDFGSSCLSRNQIHRYT
QSRFYRAPEVLLGMRYTAAIDMWSLGCILVEMHTGKPLFCGYDSADQLHRIINVLGMPPR
DLIARANPSYRREYFDEIVMTEGNNKWIDYRLKVHKVVLPKGVDVTLAEILASANKYGTL
NHSPEQYGAFHDLVMRMLDYNPDTRITPTEAMQHPFLMSMRQMQPDEMMEEPVAQGKFKY
MRASTMRDVHGRNAETQMPPLNRAKQRRFLDKSPHER
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggagatcacggatggcgcagtcgccaccaggcggccgctcaaggacacaccccgccac
cagctcacacggggcctcatgcgcacactgaacgtcatcaacgtgaactactaccggaaa
cacaaccccaaacccacaggtgtgctggccaagaagaagaaaaaggtgccggccaactac
atcttctccgaggctggcgaggagacgttcaacaacggccgctacgttgtgcgtggtcgg
aaacttggcgcgggttcgttcggtcaggtagtggaggctcaggacttgttgaccaagcag
cttgtggccataaaggttgtacagaagaagcagcagtacacagagcaagcccagaccgag
atcagcatcctgcagctgctacatttgccgcagcaacacgacgccaccaaccacatcgtg
agactgacggatacgttcatgcaccaaggacatcagtgtttggtgtttgatcgtcttgga
ccaaacctctttgacgtccttagagggacaaattttttcggaatcagtttgaagctgctg
aggaaatttacgcggcaaattctcaaggcacttgagtacatgcggcatccgaatgtcaat
gtgattcattgcgacttgaagcccgagaatattctactggtttcacacggccatagctcc
ttgaagctcatcgactttggcagctcgtgtctttctcgcaatcagattcaccgctacacg
cagagtcgcttctatcgcgccccggaagtgctactgggcatgcgatatacagcagcgatt
gatatgtggagtcttggctgcattttggtggagatgcacacgggtaaaccgctattttgt
ggctatgactcggcggaccaactgcatcgaatcatcaacgttttgggaatgccgccacgg
gatctgatcgcacgtgccaatcccagttatcgacgagaatacttcgatgagattgtgatg
actgaaggcaataataagtggattgactatcggctcaaggtgcacaaggttgttctaccc
aagggagttgatgtgacgttagcagagatccttgcaagtgccaacaaatatggcacgtta
aaccacagcccagagcagtatggcgcgttccacgacctcgtcatgcgcatgctcgactac
aaccccgacacgcgtatcacgccgactgaagcgatgcagcacccgttcttgatgagtatg
cggcaaatgcagccagatgaaatgatggaggagcctgtagctcagggaaagttcaagtac
atgcgagcttccacaatgcgcgatgtacacggacgcaatgcagagacgcagatgcctccg
ctgaatcgggccaagcaacgccgcttcctcgacaagtcaccacacgagcgatga

DBGET integrated database retrieval system