KEGG   Phytophthora infestans: PITG_00186Help
Entry
PITG_00186        CDS       T01333                                 

Definition
histone acetyltransferase, putative
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PITG_00186
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 421 aa AA seqDB search
MAPTEAGVKRTAEETQTSAVKRVRFANTASSNEVTSLAIVEAQKLEWFSPKFTYHAFGAD
EAVDGYEGLKMMVTFNGFDFRALLDVKFKEKEDTAGDVVAKLTSSLPKGFVQDKGEFVGA
LRKAATDFTGPPGKCIESYCLKSQIEDFAEERHFEIYECKLEDNEPAQKLLANLQTLSLW
FIEGADAVDVTDPRWLAYLIYERTEAGAGAFRPVGFITVFKFFNPLGRKAAYCKPDQNET
HRICQALIFPTYQRQGHAERLVQCIHAQAVANEHVYELTVEDPVPAFASLRDLVDLKNCI
KNEFFSLSPEASADAGGTGRGTEALTTADIHTVQEKLKITQKQVQTCYETRKFALVDPSD
EAQLKKFRLEVKKRLFRLHTEELDGMGADRRKAFLEAEYQKLEEHYRQMAIKNGLMNINQ
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcgccaacggaagcaggagtcaagcggacggcggaggagacccagacgtccgcagtg
aagcgcgttcgctttgcgaacacggcgtcttccaatgaagtgacgtcacttgctattgtt
gaagcgcagaagctcgaatggttttccccaaagttcacataccatgcatttggcgccgat
gaagcagtggacggctacgaaggtctcaagatgatggtgactttcaatggattcgacttt
cgcgcgctgttggatgttaagttcaaggaaaaggaagacactgcgggggatgttgttgca
aagttgacatcgtcactgcccaagggattcgttcaagataaaggcgagtttgtaggtgcg
ctgcgcaaggctgcaacggactttacgggtccaccagggaaatgcattgaatcgtattgt
ttgaagagtcaaatagaagattttgcagaagagagacacttcgagatctacgagtgcaag
ctagaagacaacgaacctgcgcagaaactacttgcaaatttgcaaactttatcgctatgg
ttcatcgaaggtgccgatgctgtggatgttacggacccacgatggctggcgtatctaatc
tacgagcggactgaggcgggagccggagctttccgtcctgtggggtttattacagtcttc
aaattcttcaatccactaggacggaaggcggcatactgcaagccggaccagaacgagaca
caccgcatttgtcaagccctcatctttcccacgtaccagcgccaaggccatgctgagcgt
ctggtacagtgcatccatgcgcaagcggtggcaaatgaacacgtatacgaactcactgta
gaggacccggtcccagcgtttgctagcctacgcgacctggtcgatctcaagaactgcatc
aagaacgaattcttctcattatccccggaggcgagtgcggatgctggcggcactggacgt
ggcacggaagcattgacgacagcagacatccacactgtccaggagaagctcaaaatcaca
caaaagcaggtgcagacctgctacgagacgcgcaagttcgcgctcgtggacccgagcgac
gaggcgcaactcaagaaatttcggcttgaggtcaagaagcggctgtttcgcttgcatact
gaggagctggacggcatgggcgccgaccgccgcaaagctttcctcgaggccgagtatcag
aaactggaagagcactatcggcagatggcgataaaaaatgggttgatgaatatcaaccaa
tcgtag

DBGET integrated database retrieval system