KEGG   Phytophthora infestans: PITG_00236Help
Entry
PITG_00236        CDS       T01333                                 

Definition
cyclin-H, putative
Orthology
K06634  
cyclin H
Organism
pif  Phytophthora infestans
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:pif00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PITG_00236
  Replication and repair
   03420 Nucleotide excision repair
    PITG_00236
Transcription machinery [BR:pif03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PITG_00236
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 398 aa AA seqDB search
MSYLAASTHFNNWVFSTEELARVRRLQHVKTKRALRLEREESQKPEASANNGRKARSFAA
LVPSSSTAMRDTFDWNDEVDVDLSGLEEAEEKANLQLTPLLEFLNPEQEALLRAFYEEKI
QESCSAQFLRTSDKVKCCAVLLFKRFYLSNSVMEFHPKFIVPTAIYVAGKVEEQYMSVDT
VADQLHVDHKFIIGHEMVLLEGVRFQLIMYHPFRALLGFLDDFRAFAKQVLKKDLPATVL
QKLHAISTAMVNDMLLTDLPLLHYPSYLALAALWHVTDDVAASSGEKACGLASADVLSYI
KRSKFSKDQPVDEVSGRLQQITQAFQALKAEKQKGGEEATQRHAKQIKQIYKKLKQFHKD
DEKKEKKKDKSSKKKDKKRKDGSKGDKKKVKKQKKDKA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtacctggcggcatcgactcatttcaacaactgggtcttctcgacagaggagcta
gcgcgtgtacggcgtctgcagcatgtgaagaccaagcgcgcgctccgactggagcgcgag
gagtctcagaagcccgaagcttcggctaacaacggtcgcaaagcgcggtctttcgctgcg
ctagtgccaagctcgtcgactgctatgcgcgacacttttgactggaatgatgaagtagac
gtggatctatcggggctggaggaagcggaggagaaggccaatctccagttaacacctctg
ctggagtttctgaacccagaacaagaggcgttgttacgagccttctacgaggaaaagatc
caggagagctgcagcgctcagttccttcgcacatcagacaaggtcaagtgctgcgccgtc
ttgctattcaagaggttttatctaagcaatagtgtcatggagttccaccccaagtttatt
gtcccgaccgctatctacgtagctggcaaggtcgaggagcagtacatgtcggtggataca
gtggctgaccagcttcatgtggaccacaagttcattattggtcacgaaatggtcttgctg
gagggtgtgcgctttcaactcatcatgtatcacccattccgcgcgctattgggctttcta
gatgacttccgagcctttgccaagcaagtactgaaaaaggatctgcccgcgacggttctg
caaaagctgcacgctatttcgaccgcaatggtgaacgatatgcttctcacagacttacca
ctgcttcattacccgtcgtatttggcacttgcagcactgtggcatgtgaccgacgatgtt
gcagccagtagcggtgaaaaggcttgcggacttgcgagcgccgatgtactgagctacatc
aagcgcagcaagttctctaaggaccagcctgtggacgaagtatccggtcggctgcagcag
attacacaggcgttccaagcgttgaaagctgaaaagcaaaagggcggcgaggaggcgacg
caacgtcatgccaagcagataaagcagatctacaagaagctcaaacaattccacaaagac
gacgagaagaaagagaagaagaaggataagagcagcaaaaagaaggataaaaagcgtaag
gacggatcgaagggagacaagaagaaagttaaaaaacagaagaaggataaggcgtaa

DBGET integrated database retrieval system