KEGG   Phytophthora infestans: PITG_00298Help
Entry
PITG_00298        CDS       T01333                                 

Definition
hypothetical protein
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     PITG_00298
Protein kinases [BR:pif01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   PITG_00298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 376 aa AA seqDB search
MAARDAVLSMTPPPRRASCGQQTGEVHFKDGNGWFYHTVSAATPTEKRKAQLFKQEAGER
QSDSDSDDDAASQQYAWSVGSTRRRSSVDSSVQLERTREIAGNLQDSILARISTLRALCD
EGFITEEEYERRKCVIVDELTFSSLAPASSTQNTVTQRRRMSFRRTEGLPLIVPHAPDFR
EMSPELAIKHVFNYSIRQWSSTQVFINLDETPFSKGSLRIVYHLQDLSTDSSVSLSNSGC
YTDSYVAKLAIDPDEDPQTYFKDIELQAHCAHYAQVYNSYTPPKRVEFIPAWVLELPERN
GALCAVEAYIPGEYRKHNNNFGSVSDDERNTPQAFSHFTYEASNHELLAVDIQGVGDLYT
DPQIHTLNGHDFVSSR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacgggacgctgtactgtcgatgactccgccgccgcgtcgcgcatcttgtggc
caacagacgggagaggtgcatttcaaagacggcaacggttggttctaccacacagtatcg
gccgctacgcctacggagaagcgtaaggctcagctgttcaaacaggaggctggtgagcgc
caaagtgacagcgacagcgacgatgacgcagcgtcgcagcaatacgcgtggagtgtgggc
tccacgcgacgccgaagcagcgtggacagctccgtacagttagagcgcacacgcgagatt
gctggtaacctgcaggacagcatactggctaggatatcgacactccgagcactctgtgac
gaaggatttatcacggaggaggagtatgaacgacgcaagtgtgtcatagtggacgaactc
acattttcatcgctagcaccggcgtcaagtacgcagaatacagtcacacagaggagacgc
atgtcatttcgaaggacggaaggcttaccactcattgttccgcacgcgccggactttcgg
gaaatgagtccggaactagctattaaacacgtattcaactactccatacgccaatggagc
agcacgcaggtgttcatcaatctggacgagacaccttttagtaaaggaagtcttcggata
gtgtaccatttgcaagatctgagcacggacagctccgtgagtttgtccaatagtggctgc
tatacagatagctacgtggctaagctggctatcgacccggacgaagacccgcagacgtat
tttaaagacatcgaactgcaggctcattgcgcacattacgctcaagtatataactcgtat
actccacccaagcgtgtcgaattcatcccagcttgggtgctcgagctacctgagcgaaat
ggtgcattatgcgcagtggaggcgtatatcccgggagaataccgcaaacacaacaacaat
tttgggtcagtgagcgacgatgaacgcaacacgccacaagctttttctcactttacgtac
gaagcttcgaatcacgaactactcgctgtggatattcagggcgtgggagatctgtataca
gacccacagatccacacacttaacggccacgacttcgtctcgtcacgctga

DBGET integrated database retrieval system