KEGG   Phytophthora infestans: PITG_00417Help
Entry
PITG_00417        CDS       T01333                                 

Definition
Patatin like protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
pif  Phytophthora infestans
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pif00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1146 aa AA seqDB search
MSLELTRLAGLATSDLWTWLRLRLAIFTRVGAKAAHKTSRLAADVRGHVEEQNPYAVGGV
ATLVAVALLLGVLFMWVASRQVRPRKTQPKAEKPPSPTSKRLRHSSRHSKSFSDLLQAER
ERMQDNRQLELEDHITFPRELRQNYGPENLKFIYDTLSKVFSFLRGEFVEPLARDLRILR
FSKGETIFEKGQLDGSILMIVNGSASLTIHGDNEEQSFSKLLGRGDTLTSSLPLLTVLVN
ELHDGECSDLVKKVCGNLSARAQEDGTRLFKIPTLAIKKVLEKYPEALYRLSQAALIQVE
KITSKSLIDHFGLSSEIINVAPLLTQETENASVNEIVDNVADSIGLYDAELRSTFASCAK
IIKRTKKQTIREAGDSTSALGVHVVLSGAVSVQVALTPQKYAELYKATKGCEVGIATCFV
GSHYVGTRHVCLEDTTLLWIPDALFCSLLQMNSVAVKCTRHLLAQYSELVCMADTSFDWL
HLHSGESLFDRGDLCDSVFTVISGRLRAVQVHSHRGKEVETSNELVRGATLGAMDMLSAG
PSNSSVFAIRDSQISQMSRNVFDYVVSKYPSVLIHFTKNLARRMPTPRVESQKTDVTGAK
SRSNYLLSLGSSATTTDGQKTGSNLPLGTIAVLSLTKMTKIQTFCSHLEMSLKTLAEVET
VSSQKAKAFLGEQWISNSRVARANLSTWMGDIESTNELVIYEADQQLTAWTKLCLRQADH
ILLLCSDTHPQQAFVSDMVSILEDAWDKRDAEISVVRIREKDWTLTAIDAAAKLEAKGSS
RSYALKKRLRLQMDSPLLPRFILPMEKYEWISGFHNVQVPFEDHRSDFMRLSRRITGNAV
GLVLGGGGARGLAHIGVLRALEECGIHVDVVGGTSIGAFIGGIYAMHPNNLDLVESKVQQ
LSAGLSSIFEKLRDLTLPISSFFNGSRFNQSIRALFYDLSIEDLMLNYFCVSTDIAKSRM
SVHRSGPAWKYVRASMSLQGYFPPISENGSLLLDGGYMNNLPADVMKEEGGIKYIFAVDV
ASESCTDWYDYGSALSGWWLLWNKLNPFSKTVAVPSMGDVSAALAYVSSEQHKDRIKEEC
VDLYLRPPVKDYGTLEFNKKDEIIQVGYKYALPRVKAWMDRVLDAEPDADIKQTTPPSTP
AKVSTT
NT seq 3441 nt NT seq  +upstreamnt  +downstreamnt
atgtcactggagctcacacggctcgcaggcctcgccacgtccgacttgtggacgtggcta
cgcttacgactcgccatcttcacgcgcgtcggcgccaaggcggcgcacaagacgtctcgt
ctagcagctgatgtacgcggccatgtcgaagagcaaaatccgtacgcagtgggtggtgtg
gccacacttgtagctgtcgcgctgttgctcggcgtactgttcatgtgggttgcgtctcgc
caagtgcgaccgcgtaagacgcagcccaaggccgagaagcctccgtcgcctacatcaaag
cgtctgcgtcacagctcgagacattccaagtccttctccgacctgctacaagctgaacgt
gagcgtatgcaggataaccgccaactagaactagaagaccatatcacgttccctagagaa
ttacgtcagaactacgggccagagaacctcaagtttatctacgatacactatccaaagtc
ttctccttcctacgcggcgaatttgtcgagcctctagctcgagatctgcgtatcttacgc
ttctccaaaggcgagacgatcttcgagaaggggcaactcgatggctccatcctcatgatc
gtcaacgggtcagcgtcccttacaatccacggagacaacgaagagcagagtttctccaag
ttattaggacgtggtgacaccctcacgtcatctttacctttacttaccgtcctagtaaac
gagctacacgacggagaatgcagcgacctcgtgaagaaagtatgcgggaatttatctgca
cgcgcacaagaggacggtacgcggctgtttaaaatcccgacgttagcgatcaaaaaggtg
ctggaaaaataccccgaagcgctctaccgactgtcccaagcagctttaatccaagtggag
aagatcacgtccaagtctctgatcgatcacttcgggttatcatccgagatcatcaacgtg
gctccactattgacacaagagacggagaacgcgtcggtcaacgagatcgtggacaatgtg
gcagattctattgggttatatgacgcagagttacgttcgacattcgctagttgcgcgaag
attattaaacgcactaagaagcagacgatccgtgaagctggcgacagtacgagtgcgttg
ggtgttcatgttgtactgtccggagcggttagtgttcaggtcgctctaacgccgcagaag
tatgcagagctgtacaaggctacaaaaggctgtgaagtggggatcgcgacgtgctttgtg
ggctcgcattacgtcggtacacgccatgtttgtcttgaagacacgacgctgttgtggatc
cctgacgctctcttctgcagcctattgcagatgaattctgtggctgtgaaatgcacacga
cacttgctggcacagtactcggagctggtgtgtatggccgacacgtcgttcgattggctg
catcttcacagtggcgaaagtctgtttgatcgtggagatctgtgcgattcagtgttcacg
gttattagtggtcgacttcgagctgttcaggtgcattcgcatcgtggcaaggaagtggaa
acgagtaatgaactcgtgcgtggagccacgcttggtgcgatggacatgctgtcagctgga
cccagtaactcatcggtgttcgcgatccgtgactcgcagatctcgcagatgtcgcgtaat
gtgttcgactatgtggtgagtaaatacccgtccgtgctaattcatttcacgaagaacttg
gctcgtcgaatgccaactcctcgtgtggaatcacagaagactgatgtgactggcgcaaag
tctcgcagtaactatctgctgtctctgggctccagtgcgacaactactgatggtcagaag
acaggcagcaatctgccactgggtactattgctgttctctcgctgacgaagatgacgaag
atccagacgttctgttcgcacttggagatgtcgctgaagacgctagcagaagtggaaacc
gtgtcgtcgcagaaagccaaggcgtttctaggagagcagtggatcagtaattctcgtgtg
gccagagctaatctctcgacctggatgggagatattgagagtaccaacgagttggtaatc
tacgaggctgatcagcaattaacagcgtggacgaagctctgtttacgtcaagcagatcac
atcttactgctctgctcggacacacatcctcaacaagcgtttgtgagcgacatggtgtcg
attttggaggatgcatgggacaagagagacgccgagatcagtgtcgttcgtatccgtgaa
aaggactggacgctgacggctatcgacgctgctgcgaagctggaggcgaagggatcatca
cgttcctatgcgttaaagaagagattgagactgcagatggacagtccgttgctgccgcgt
ttcatcctcccgatggagaaatacgagtggatcagtggcttccacaacgtccaagttccg
tttgaagaccatcgctcggatttcatgcgtctaagtcgtcgaatcactggaaatgccgtc
ggtttagtgctcggaggcggtggagcgagaggtttagcacacattggtgtactccgcgca
cttgaggagtgtggtatccatgtagatgtcgttggtggtaccagtatcggcgcgtttatt
ggcgggatatacgcgatgcatccgaacaatttagacctcgtggagtcgaaagtgcagcag
ttatcggcaggtcttagcagtatcttcgagaagctacgagacctcacactgcccatttcc
tccttcttcaatggcagtcgcttcaaccagagtatccgtgcgctcttctacgacttgtcg
attgaagatctcatgcttaactacttctgcgtgtccacggacatcgccaagtcccgtatg
agtgtccatcgcagtggtccagcgtggaaatatgtgcgtgcgtcgatgagtctacaaggc
tatttccctccaatctcggagaacggctcgttgctactggatggaggctacatgaacaat
cttcctgctgatgtcatgaaggaggaaggaggcatcaagtatattttcgccgtggacgtg
gccagcgagtcgtgcacggattggtacgattacggaagtgccttgtcgggctggtggctg
ctttggaacaagctcaatccgttctccaagacagtggcggtgccgtctatgggtgacgtg
tctgcggcattggcgtacgtgtcgtcagagcagcacaaagaccgcatcaaggaagagtgc
gttgatctgtacttgcgtcctcctgtcaaagactatggcactctggagttcaacaagaaa
gatgagatcatccaagttggctacaagtacgcgttgcctcgtgttaaagcctggatggat
cgagtgctggacgccgaacctgacgctgatatcaagcagacgactcctccgtccacacct
gccaaggtcagtacgacgtaa

DBGET integrated database retrieval system