KEGG   Phytophthora infestans: PITG_00492Help
Entry
PITG_00492        CDS       T01333                                 

Definition
cytochrome c peroxidase, mitochondrial precursor
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PITG_00492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 335 aa AA seqDB search
MLRRAAIRAAQVSAVSKTRGFATSQLRTANKKKQPSAIVLAAAGVAAVSGLALTDLVNAR
EKAVDLDAIKKEIIDIFDEDNYMGPTMVRLAWHSSGSYSGKDNSGGSTGGTIRFDPEINH
GGNAGLHLAVKALEKVKKNHPEITYADLYILAGATMIEEMGGPEIPFRLGRPDAKSGKEP
TQTPDDRLPNADMGSKDKTTQHVRDVFYRMGFNDRDIVALVGAHAIGRCYPTRSGYSGPW
TNAEWTFSNEFFRELIENKWTIKKWDGPMQYEDPTGKLMMLPADIVMIQDPEFKKYVELY
AKDEELWFKDFSKAFVKLTENGVKFPKSGWFSFFS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgccgtgccgctatccgtgccgcccaggtgtccgccgtctccaagacgcgtggc
ttcgcaacctcgcagctgcgcacagccaacaagaagaagcagccgagcgctatcgttctc
gccgccgcaggcgtcgccgccgtgagcggcctggccctaactgacctggtgaacgcgcgc
gagaaggccgtggacctggacgccatcaagaaggagatcattgatatcttcgacgaggac
aactacatgggccccaccatggtgcgtctcgcgtggcactcgagcggctcgtactcgggt
aaggacaacagcggaggctcgacgggtggcaccatccgctttgacccggagatcaaccac
ggcggtaatgctggtctgcatctggctgtcaaggccctggagaaggtcaagaagaaccac
ccggagatcacgtacgctgacttgtacatcctggccggtgccacgatgatcgaggagatg
ggaggccccgagatccccttccgtctcggccgtccggatgccaagagcggcaaggagccg
acgcagactcccgatgaccgtctgcctaacgccgacatgggtagcaaggataagaccacg
cagcacgtgcgcgacgtattctaccgcatgggcttcaacgaccgcgacatcgtggcgctc
gtgggcgcacacgctattggacgctgctacccgacacgaagtggctacagtggcccatgg
actaacgccgagtggacattctcgaacgagttcttccgtgaactgatcgagaacaagtgg
acgattaagaagtgggatggccccatgcagtacgaggacccgacgggtaagcttatgatg
ctacctgccgacattgtgatgattcaggacccagagttcaagaagtacgtcgagttgtac
gctaaggacgaggaactgtggttcaaggacttttccaaggctttcgtcaagctcacggag
aacggcgtcaagttccccaagtcaggctggttcagtttctttagctaa

DBGET integrated database retrieval system