KEGG   Phytophthora infestans: PITG_00720Help
Entry
PITG_00720        CDS       T01333                                 

Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pif  Phytophthora infestans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PITG_00720
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PITG_00720
   00620 Pyruvate metabolism
    PITG_00720
   00640 Propanoate metabolism
    PITG_00720
Enzymes [BR:pif01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PITG_00720
Lipid biosynthesis proteins [BR:pif01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PITG_00720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 660 aa AA seqDB search
MGDSAGVSVNGQYPPIQELAKTAHIKNFEQYEAMYKRSLEDPENFWGELARENLDWFRDF
DQSVVGTVNKGDVAWFLNGQINVSVNCIDRHVKKHADKVAIIWEADEIGQGREITYTELL
EETCRVANAMKHAGVKKGDTVAIYMPMIPEIAFVMLACTRIGAVHSVVFAGFSADALRDR
LIDANTHWVFTSDEGKRGGRTLPLKQIVDVAVDGLDFVRNVFIFKRTHNPNVKMNPKIDV
DMDEEMKRHRPYCAAEFMNAEDLMFILYTSGSTGAPKGIAHTTAGYLLYAMITCKYTFDL
QPDDIYACVADAGWITGHSYIIYGPLANGVTTLMFESTPMYPDHGRYWDLIQRYKVTKFY
TAPTAIRALMARGNDKIKDYDLSSLKILGSVGEPINPEAWKWYYEVVGNRQCYIADTYWQ
TETGGHIGVGLPGATPMKPGSCTKPFFGIDFVVTDENGNEIKGNDVEGQLCIRKPWPGMA
RTVYGNHNRYLLTYMATHKGLYFTGDGCRRDKDGYYFITGRIDDVLCTSGHRIGTAEVEN
TLVAHSVVAEAAVIGIPHRIKGEGICCFVMLVEGVEPSKEVEKELVQQVRAHIGAFASPD
LIVLVPGLPKTRSGKIMRRVLRKISHGEEDSLGDVSTLADPSVVPVLITNTKAALVGTSF
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacagtgccggcgtgagtgtcaacggacagtaccctccgatccaggagctggcc
aagacggcccacatcaagaactttgagcagtacgaggccatgtacaagcgttcgcttgag
gatccggaaaatttctggggcgagctggcccgcgagaacctcgactggttccgcgacttc
gaccagagcgttgtgggcaccgtcaacaagggcgacgttgcctggttcctcaatggccag
atcaatgtgagcgtcaactgtatcgatcgccacgtcaagaagcacgcggacaaagtggcc
attatctgggaggctgatgagattggccaaggccgtgaaatcacctacacggagctgctg
gaggagacgtgccgcgtggccaacgccatgaagcacgctggtgttaagaagggcgacact
gtggccatctacatgcctatgatcccggagattgccttcgtcatgctagcctgcacacgt
attggtgccgtgcacagcgtcgtgttcgctggtttctcggccgacgctctgcgcgaccgt
ctcattgacgccaacacgcactgggtcttcacctcggacgaaggcaagcgtggcggtcgc
acgcttccactcaagcagattgtcgacgtcgcagtggacggtctggactttgtgcgcaac
gtgtttatcttcaagcgtactcacaacccgaacgtcaagatgaaccccaagatcgatgtg
gatatggatgaagaaatgaagcgtcaccgtccctactgcgctgctgagttcatgaacgcg
gaggacctcatgtttatcctgtacacgtctggatctacgggtgctcccaagggtatcgcc
cacacgacggccggctacctgctctacgctatgatcacatgcaagtacacgttcgacctg
cagcccgacgacatctacgcttgtgtggccgacgccggttggatcactggccatagctac
atcatctacggcccgttagcgaatggagtcaccacgctcatgttcgagagcacgccgatg
tacccggaccacggtcgctactgggacttgatccaacgctacaaggtgaccaagttctac
acggccccgactgctatccgtgccctgatggctcgtggcaacgataagatcaaggactac
gacttgtccagcttgaagatcctgggcagtgtcggcgaacccatcaaccctgaggcctgg
aaatggtactacgaagtggtaggcaaccgccagtgctacatcgctgatacgtactggcag
acggagaccggcggacacattggcgtgggtctgcctggtgctactccgatgaagcctggt
tcctgcaccaagccattcttcggcatcgatttcgtggtcactgatgagaacggcaatgag
atcaagggcaacgacgtcgaaggacagctgtgcatccgtaagccgtggcctggcatggcc
cgtactgtgtacggcaaccacaatcgttatctgctgacgtacatggcgacgcacaagggt
ctgtacttcactggtgacggctgtcgtcgcgataaggacggctactacttcatcacgggt
cgtattgacgatgttctctgcacttctggtcaccgtattggcacggctgaagttgagaac
actctggtggctcacagtgtcgtagcagaggcggctgtgatcggtattcctcaccgtatc
aagggcgagggtatctgctgcttcgtaatgcttgtcgagggtgttgagccgtccaaggaa
gtcgaaaaggaactggtgcagcaggtgcgtgcccacatcggcgccttcgcctcaccagat
ctgatcgtgctggtgccgggcctaccgaagacgcgcagtggcaagatcatgcgtcgcgtc
ctgcgtaagatctcgcacggcgaggaagactcgctgggcgatgtgtccacactcgcagat
ccttccgtagtgccagttctgatcaccaacacgaaggcggcgctcgtcggcacgtcgttt
taa

DBGET integrated database retrieval system