KEGG   Phytophthora infestans: PITG_01029Help
Entry
PITG_01029        CDS       T01333                                 

Definition
pectinesterase, putative
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
pif  Phytophthora infestans
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:pif00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pif00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 338 aa AA seqDB search
MQIFAPLVALASLAAASEGACTGTNARTTPPPGAIVIDATGAYSGSFKTVSEGVANLPKT
AVQQILFLMPGTYEEQVTIPKLKGNLVVQGYTCDTTSYSSNQVTITHAMAQKDVPANITK
SRNDYTTTLLIKASNVKVYNLNVANTAGDVGQAIAMKVDGANNGVYACNLTGYQDTLYAN
KGPELFAKSYISGAVDFVFGLYAKAWFESCDIESVGKGCITANGRTNDSNPSEYVFNNAR
VFGSTPGQAFLGRPWRPYARVVFQNSDLSDVINPAGWQKWNGDNNTANVYFKEYSNRGAG
AATNNRVGFSGTLEKPVAITEILGAGYESAWWVDKSFL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcagatatttgctcccctcgtcgcccttgctagcctcgccgcagcctcggaaggtgcc
tgtaccggaacgaatgctcgcactactcccccaccaggtgccatcgtcattgacgccacg
ggtgcgtacagcggcagcttcaagaccgtgtccgaaggagtggccaatcttcccaaaacg
gcggtgcaacaaattctcttcttgatgccggggacttatgaggagcaggtcacaattccg
aagcttaaaggcaacctggttgtgcagggctacacttgtgacacgacatcgtactcttcg
aaccaggtcactatcacccacgccatggcgcaaaaggatgtccctgccaacatcaccaag
agccgcaatgactacacgaccacgctgctgatcaaggcgagtaacgtgaaggtgtacaac
ctcaacgttgccaacacagctggcgacgttggccaggccattgctatgaaggtcgacggc
gccaataacggagtttacgcctgcaatctcaccggctaccaagacactttgtacgcaaat
aagggtcccgagctcttcgccaagtcgtacattagcggtgccgtcgacttcgtctttggt
ctgtacgcgaaggcctggtttgagtcctgcgacattgagtctgttggcaaaggctgcatc
actgctaacggccgcacaaacgattcgaacccttccgaatatgtcttcaacaacgcacgc
gtcttcggttccactccgggtcaagccttcctgggccggccgtggcgaccgtatgcccgc
gtcgttttccaaaacagtgaccttagtgatgttatcaacccagcaggttggcagaagtgg
aacggtgacaacaatacggctaacgtctacttcaaggagtacagcaacagaggagcagga
gcggctaccaacaaccgtgttggtttcagtggaacgctggagaaacctgtggcgatcacg
gaaatccttggtgcgggctacgagtccgcctggtgggtggacaagtcgttcctgtag

DBGET integrated database retrieval system