KEGG   Phytophthora infestans: PITG_01029Help
Entry
PITG_01029        CDS       T01333                                 

Definition
pectinesterase, putative
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
pif  Phytophthora infestans
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PITG_01029
   00500 Starch and sucrose metabolism
    PITG_01029
Enzymes [BR:pif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     PITG_01029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 338 aa AA seqDB search
MQIFAPLVALASLAAASEGACTGTNARTTPPPGAIVIDATGAYSGSFKTVSEGVANLPKT
AVQQILFLMPGTYEEQVTIPKLKGNLVVQGYTCDTTSYSSNQVTITHAMAQKDVPANITK
SRNDYTTTLLIKASNVKVYNLNVANTAGDVGQAIAMKVDGANNGVYACNLTGYQDTLYAN
KGPELFAKSYISGAVDFVFGLYAKAWFESCDIESVGKGCITANGRTNDSNPSEYVFNNAR
VFGSTPGQAFLGRPWRPYARVVFQNSDLSDVINPAGWQKWNGDNNTANVYFKEYSNRGAG
AATNNRVGFSGTLEKPVAITEILGAGYESAWWVDKSFL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcagatatttgctcccctcgtcgcccttgctagcctcgccgcagcctcggaaggtgcc
tgtaccggaacgaatgctcgcactactcccccaccaggtgccatcgtcattgacgccacg
ggtgcgtacagcggcagcttcaagaccgtgtccgaaggagtggccaatcttcccaaaacg
gcggtgcaacaaattctcttcttgatgccggggacttatgaggagcaggtcacaattccg
aagcttaaaggcaacctggttgtgcagggctacacttgtgacacgacatcgtactcttcg
aaccaggtcactatcacccacgccatggcgcaaaaggatgtccctgccaacatcaccaag
agccgcaatgactacacgaccacgctgctgatcaaggcgagtaacgtgaaggtgtacaac
ctcaacgttgccaacacagctggcgacgttggccaggccattgctatgaaggtcgacggc
gccaataacggagtttacgcctgcaatctcaccggctaccaagacactttgtacgcaaat
aagggtcccgagctcttcgccaagtcgtacattagcggtgccgtcgacttcgtctttggt
ctgtacgcgaaggcctggtttgagtcctgcgacattgagtctgttggcaaaggctgcatc
actgctaacggccgcacaaacgattcgaacccttccgaatatgtcttcaacaacgcacgc
gtcttcggttccactccgggtcaagccttcctgggccggccgtggcgaccgtatgcccgc
gtcgttttccaaaacagtgaccttagtgatgttatcaacccagcaggttggcagaagtgg
aacggtgacaacaatacggctaacgtctacttcaaggagtacagcaacagaggagcagga
gcggctaccaacaaccgtgttggtttcagtggaacgctggagaaacctgtggcgatcacg
gaaatccttggtgcgggctacgagtccgcctggtgggtggacaagtcgttcctgtag

DBGET integrated database retrieval system