KEGG   Phytophthora infestans: PITG_01453Help
Entry
PITG_01453        CDS       T01333                                 

Definition
ubiquitin-specific protease, putative
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PITG_01453
Peptidases [BR:pif01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PITG_01453
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2859 aa AA seqDB search
MDRAPAQDKDSQKRRKKSQESTSGLATDMEEEELELFHVVQEDLRHKSTVGWQNAVKVLN
SAYQHIDRPESQAFLDDAFQKIVSIMLDQHASKIGSFEKSCVTQCLSLAVPLVIAQMKAG
KYFQTLPVLTMIFSKKKTFYKDLRTSAMIGSYWNKVPGSPEVRAQCIEAFCEMKGFHLLL
STLELLMQNHREGDELEAAMDSEDIRILLQALLEFRTSVPETICTKISVLIMTYFTKISD
FVLKKESSDAVGAVIGIIRRLVDAGIVSSEATNALWLDITERYVESTSLPLRLFGLEQIN
QIVNCARASRAFPPRYFVRNAGTAAVNGVYTLKANSTSATYVFRQQETGQVFTLFCCTMK
SGLKWWFISEADKMQPGSDQDIDYYQHQSQYEEYLPPTHNWIPTGKGEAPAPELVAESVQ
ENDDEDRSRLDYKLSAWVVEKKILEEIFGDRIHREIVSRSALLVKFLADSNKLDTHSIDV
IWQSCIQKDQTLVHEIHNLLIATVPFLTNELLLHLVESIHASLLRSLEKNEPFPELISFL
QRLATNSPSFLMDRNVNVTTAILQLLWSIQMHCSIANIRLSRSLRDFFQEGLRSEYGEPL
RKAFLNECLEGIKKSCSLTSSAPDAATSPSSTLIPPALSSSSSSSVALTNSAELSAKDAT
ASKSLELLKFLIDSYRADQALVVETLNSEHGLVSLLFDELATFVARSTDKQSPSYRTAIG
HRLELIHYIHVKSPKLELSIPQIERLWHVLSSSPAEREYCLIFFNQTSMKSGTAPGTSTV
GGSISSAFNLDVCFYVFNELLCKQTNFRTLGCMGYKCFNTYFVGLNAQRKLMQHAEEASE
CGSLNLLGMDALWRIAFEAPLEVAEMATRELLRVYERSSDEPTHNDDSESDEAVKDFLAR
VFKQLSTVEDSTPDSLKQVQQCSSLLAGLVSSARKKQNFVSHGLSGRGAYFTIKIIAQRI
PSSNTSGTGMTTAASSHDNAVRTMQAAAYSNQTLLHFRKRIEKLVGHPMLQTKILSSGSA
ITGDQKTLADLQITESSELRVLMFNSVVQRSSSSVMDQDQVMTSGKESSSSSSSFSPKRH
PGLVIARDASYFGIMFRVLDIVEGHAVHELLWAFLKQIPTSEELLNRVSNIGATETSDGD
VNMSPLDDTANGASKPDWSSLVKGISSHQAIYTLQIMDALLLPSDAAKIPFAHTYLQRFI
SGGGFHEVLSYFINANFHESSFNEGAAVALRILKFCLFDSGHDNGLYSATANGDAPVETP
RSKIIVEQSRYDQLVLKIAELVVSEYTRVEEKIPAKKTAYRILIDAVKTVESIVSIANDA
AAKYIKALEPRAIIVNIFTKFESEQVRDQWLSSLESVCKASDAAAEVVFEECIQSVGRIE
SVTAPCDQYTRMLCLLARLEGGKSSSYCQKLALAVVTKLRRGFSSKFLACNERSGEVLIG
FLEFLREVLVVHADVRAGIARDIVDVVYEECLFTLPSEDRRRCPLCVSLETRRPAFKLLA
SAISSDARILHDLHGRLTKLFTQSDALRFKWGQENNIETRGNGEHVGLKNQGCSCYMNSF
LQQLFMHPTLRQGLLGAKVAPRPTPQEPTKAEAEKYPERLIGCRVALECLGGRVYEANVV
GYDDLSGQHTMRYENGGEATFVLAEGRPGNENGRYVILQPELTGTDATLEVLRQLQRTFC
YLRDSEMRYFNPKAFVDSCTCLNLEFSVYQQNDATEFCDKLLDRLETGLKTTPQGTRCLQ
DVMGGKLISQKLPKDCGHRYEREEPFIRLELQIRGKESIEESLSAFVEGELMDGDNKVEC
ELCATKKAAVRRTCFGSLPNLLILHLKRFDLDYTTFETVKLNNRCSFPMRLSMKPYTKAG
IEEQEARSNLQQDRGETSADEDMASDDSSDSDEFMADVNGDTPAIPASSSASTKSDPNYE
YRLKGILVHSGVAQGGHYYSFIYDHMSEKWFKYDDEDVTPFDPANIEAECFGGVQRRSWH
GSNNSMEMEVFSNALMLFYEKVIPVEPEVAPATESEASVQVVTAAPDEERCEYEAEVWKS
NEVFLQNSYLFDVEFHEFLREMVQSQYIKDSLVAAAEDDIPMAISPSPGTNVVTAPPAAP
VALAVPALAADEEIQVTLTDIGVEFVLSVLLHSREKHGIARWITLLASKFTRSKTICVRF
FSALSTSKRVFWLRGLLFECPDSIARQSFVHLVSRALTAYEVHRKEEQATVNEARSEAAA
AADTTVIRAFLETIASFLDQTSIMQQSHLEECFMLLRNCAEISATARTQLQQLEMIARLI
NFFLCDRGPSALKDAFPSSTLQPTASRYASPDYQYLLEAVTAILGLPRRTTEPLLTENST
QYPHRTVLSEKAEQALTEIFEDYQTPGGASGNLGLGLEELKKFFSVSLSSATTSPAVEQQ
ARHMLTKYGTPLDGFMLYYTDMAASSTKSVLQDLRAFGFSEDLQRHSLSSGDVPTGAQIL
EGLSPLSRGALLNDVFFDSALEEEAETTCELLLRLSLGDHETSTRLLRALLHCLQSTETG
WKGQPVVDACALAVQRVLGYECDYQKELVELALVHSDYGLLSSARSRENLRSRYVNTAHV
PLFVYRQLVLVLELRARVPAVNSWLADHRNKWEWLYEWLRIESLQPSLGGRLSQLRREPA
KLEMLWRLGEALGISYQEEQRRYVVEGAGYAAVNGVYVSTSHVHDNCLTYACVKSDIEYT
LFRCCMPSKARRWYISYSPNKNLLGTMSDEDFYFVQSHIDDESPPVDGWKVWVKNEKAKA
PVPTVRLHSSTVAALDGEGDAADATDSVDGFMARGGFDDGSSAPTAPSPEMVVETVDVDA
DAETVEYDDSEDEIRDSNERFRAVHLDTQEDGSSTDDFM
NT seq 8580 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtgcgcccgcccaggacaaggacagccagaagcgacgtaaaaagagccaggag
agcacaagcggcctcgcaacagacatggaggaagaggagcttgagctcttccacgtggtg
caggaagatctgcgccacaagtctacagtgggatggcagaatgccgtcaaggtgcttaac
tcggcctaccagcacatcgatcgccccgagagccaggcttttctggacgacgccttccag
aagatcgtcagcatcatgctggaccagcatgccagcaagatcggatcctttgaaaagtcg
tgtgtgacgcagtgcctgtcactcgcagtaccgctggtgatcgcgcagatgaaggcaggc
aagtatttccagacgctaccggtgctgaccatgatcttcagcaagaaaaagactttttac
aaggacttgcgcacctcggcgatgattggcagctactggaacaaggtgcccgggtcgccc
gaagtgcgagcgcagtgcatcgaagcgttctgcgagatgaaagggttccacttactgctg
agcacgttggagctgctaatgcagaaccaccgtgaaggcgacgagctagaagccgcgatg
gacagcgaggacattcgtatcttgctgcaagcactgctggagttccgaacatctgtcccg
gaaaccatctgcaccaagatctcggtgctgattatgacgtactttacgaagatctcggat
ttcgtgctgaagaaagagtcgagcgacgctgtgggagccgtgattggcatcattcggagg
ctggtggatgcggggattgtgtcgtccgaggctaccaacgcgttgtggctcgacatcacc
gagagatacgtggagtccacgtcgctgcctctgcgactctttggcttggaacaaatcaat
cagatcgtgaattgtgcccgagcgtcgcgagcgttccctccacgatactttgtgcgcaac
gctggcaccgctgccgttaacggtgtgtacacgttgaaggccaactccacgtcggcaacg
tacgtcttccgacagcaagaaacgggccaagtgtttacgctcttctgctgcacgatgaag
agtggcttgaagtggtggtttatctcggaggctgacaagatgcagcccggatcagatcaa
gatattgactattatcagcaccagtcgcagtacgaagaatacctgccacccacgcacaac
tggattcccacgggaaagggagaggctccggctcctgagctagttgcggagagtgttcag
gagaacgacgatgaggatcgcagccgactggactacaaattgagtgcttgggtggtggag
aagaagattctggaggagatttttggtgaccgaatccatcgtgagattgtgtcacgcagt
gcgttgctggtgaagtttttggcggattccaataagctggatacgcactccattgacgtg
atttggcagtcgtgtatccagaaagaccagacgctcgtgcacgaaatccacaacttacta
atcgccacggtgccatttttgacaaatgagctgctactgcatctggtggaaagtatccat
gcctcgttattgcgaagcctggagaagaacgagccgttccccgagctgatatcgttttta
cagcgactggcaacgaactcgcccagctttctcatggatcgcaacgtgaacgtcacgacg
gcgatcttgcaactgctgtggtcgattcagatgcactgcagtatcgctaacattcgacta
agcaggagtttgcgggatttcttccaagaagggctgcgaagcgagtatggcgagccgctc
cgaaaggcgttcctaaacgagtgcctcgagggaatcaaaaagtcttgctcgttaacaagc
tcggcgccagatgccgctacatctccgtcatctaccttgattcctccagcgttaagcagc
agcagcagcagctctgttgccttgacgaattcagcagaattatctgctaaggacgcaacg
gcttcgaaatcattggagttgcttaagttcctgatcgactcgtatcgagctgatcaggct
cttgtggtggaaacgctcaattccgagcacgggttagtgagtttgctatttgatgagctg
gcgacttttgtggcacggagcacagataaacagtctccaagttaccgcacggccattggt
catcgcttagaattaatccactacattcacgtcaagtcgccaaagttggagctctcgatt
ccacagattgaacgcttgtggcacgttctctcgtcgtcaccggccgagcgcgaatattgt
ttgatatttttcaaccagacgagcatgaagagcgggacagcacctggtacgagcactgtc
ggtgggtcgataagctcggcctttaacttggatgtatgcttctacgtcttcaacgagctt
ctgtgtaagcaaacgaatttccgcacgctgggatgcatgggctacaagtgctttaacacc
tactttgtgggtctcaacgcccaacgcaagttgatgcaacacgccgaagaggcgtcggaa
tgtggctcgctgaatctgctgggaatggatgctctgtggcgaatcgcgtttgaagctcct
ctagaagtcgccgagatggctacacgtgagctgcttcgggtttatgagcgatcgtccgac
gagcccactcacaacgatgacagcgaatcagatgaggccgtgaaggatttcttggcgcgt
gtgtttaaacagctgtctacagtggaggacagcacaccggactcactgaagcaagtgcag
cagtgctcaagtcttttggcaggactggtgtctagtgctcgcaagaagcagaattttgtt
tcacatggtctaagcggtcgcggtgcctactttaccattaagattattgcgcagcggatc
ccttcgtccaacaccagcgggacgggtatgacgactgcagcctcaagccacgacaatgca
gtccggacgatgcaggcagcagcatactcgaaccagacgttgctgcacttccgcaagcga
attgaaaagctggtgggccatccaatgctacagacgaaaattttgtcgtcggggtcagca
attacaggtgatcaaaagacattggcggacttgcagatcacggagtccagtgagttacgc
gtgctgatgttcaattcggtggtgcagcgctctagctccagtgtgatggatcaggatcaa
gtgatgacttcaggcaaggaatcgtcttcttcttcttcatccttctcgccaaagcgtcac
cctggtctagtgattgcacgcgatgcctcgtactttgggattatgtttcgtgtactcgac
attgtggagggccatgctgtccacgagttgctgtgggcctttttgaagcaaatccctact
agcgaggagcttctgaaccgtgtttccaacattggcgcgactgagacgagtgacggagat
gttaatatgagccccttagacgacacagccaacggagcgagcaagcctgattggtcatct
ttggtaaaaggaatatcgtcccaccaggctatttacacgcttcaaattatggacgcgctg
ctgctgccttcagatgccgccaagattccattcgcccacacgtacctgcaacgcttcatt
tctggaggaggattccacgaagtgctttcgtattttatcaacgcaaatttccatgagagt
tccttcaatgaaggtgctgcggtggctctgcgtatcctgaagttctgtctgttcgactcg
ggccatgataatggactgtactcggctactgcaaacggggacgctccagtcgaaactccg
aggtcaaaaataattgtggagcaaagtcggtatgatcagttggtgctgaaaatcgcagag
ctcgttgtgtcggaatacacgcgcgtggaggagaaaatccctgcaaagaagactgcgtat
cgtatcttgattgatgccgtgaagaccgtggagtcgattgtgtccattgcgaatgatgca
gcagcgaagtacatcaaggcgctggagccacgcgctatcattgttaatatttttaccaag
tttgaatcggagcaagtgcgggaccagtggctctcatcattggagtctgtttgcaaggcg
tctgacgcagcagccgaggtggtctttgaggaatgcatccaatcggtcggtcgtattgaa
agtgtgacggcgccgtgtgaccagtacacgcgcatgctttgcttgttggcacgtcttgag
ggtggcaagtcgtcttcatattgccaaaagttggccctggcagtagtaacaaagttgcgt
cgtgggttctccagcaagttccttgcctgcaacgagcgttcgggcgaagtgctgattggc
ttcttggagtttttgcgtgaggtgttagtggtacatgcggatgtgcgcgccggaatcgct
cgagacatcgtagacgtcgtttacgaggagtgtttattcacgctaccatctgaagatcgc
cgtcgctgtccgctgtgtgtgtcactggagacgcgacgtcctgcgttcaagctgctcgcg
agcgcaatatcttcagatgctagaatcctgcatgacttgcacggtcgcttaaccaagctc
ttcacacagagtgacgcgctgcggttcaagtgggggcaagagaacaacatcgaaacgcgt
gggaacggcgagcacgtcgggttaaaaaaccaaggctgttcgtgctacatgaactcattc
ttacagcagctgttcatgcacccgacgttgcgccaaggtttgcttggcgccaaggtggca
cctcgcccaactcctcaagaacctacgaaagcagaggcagaaaagtacccagaacgcttg
attggctgtcgtgtggcgttggagtgtttgggtggccgagtctacgaagcaaacgttgtg
ggatacgacgatctgagtggtcaacatacgatgcggtacgaaaatggaggcgaggcgacc
tttgtgttggcggaaggaagaccaggaaatgagaatgggcgctatgtgattttgcagccg
gagttgacgggcactgacgcgacgttggaagttcttcgtcaacttcagcgcacgttctgt
tacttgcgcgacagtgaaatgcggtacttcaacccgaaggcgtttgttgactcgtgcact
tgtctgaatctcgagttctcggtgtaccagcagaatgatgcgaccgagttttgtgataag
ctactggatcgcctagaaacgggtctgaaaacgacaccacaaggcacgagatgtctccag
gacgtgatgggcgggaagcttatctcgcaaaagcttccgaaggattgtggacatcgatac
gaacgtgaagagccatttattcggttggagctgcagatccgtgggaaggaaagcatcgag
gaatcgctctccgcgttcgttgaaggagaactcatggatggcgacaacaaggtggagtgc
gagttgtgtgctaccaagaaggcagctgtgcgacgaacctgcttcggctcgcttcccaac
ctgctgattcttcacttaaagcgtttcgatctggactatacgacgttcgagacagttaag
ctgaacaaccggtgctcgttccctatgcgtctgagcatgaaaccttacaccaaggcgggc
atcgaagagcaggaagctcgctcgaacttgcagcaagaccgtggagaaacatcggcggac
gaagacatggcgtctgatgactcgagcgactcggacgagtttatggccgacgtgaatggc
gatacgcctgcaatcccagcttcatcctcagcgtccaccaagtcggaccctaactacgaa
tatcggctgaagggtattctggtgcactctggagtcgctcaaggtggccactactactcc
ttcatttacgaccacatgtctgagaagtggttcaagtatgacgacgaggatgtgactcca
tttgatccagccaacattgaagccgagtgctttggaggagtgcaacgacgctcgtggcac
ggctcgaacaattctatggagatggaagtcttcagcaacgcgctcatgctattttatgaa
aaagttatccccgtcgagcctgaggtagcacctgccaccgaatctgaagcctctgtacaa
gttgttactgctgctccggatgaagaacgctgcgaatatgaagctgaagtgtggaagtcc
aacgaggttttcctgcaaaactcgtatctgtttgatgtggaattccatgagttcctacgt
gagatggtacagtcccagtacattaaagactctctggtcgcagcagcggaggacgatata
cctatggccatatcgccatcgccagggacaaacgtcgtgacagcccctccagctgcaccg
gtggcactagcagttccagcactggcagcagatgaagaaattcaggtgacgctgacggac
attggcgtcgagttcgttctaagtgtattgctccattcacgggaaaagcatgggatcgcg
aggtggatcacgctgctggcgtctaagttcacgcggtcaaaaactatctgtgtacgcttc
ttctcggctctatcgacgtcaaagcgcgttttctggttgcgtggattgctgttcgagtgc
cccgattcgattgctcggcagtcatttgtacacttggtttcgcgagcacttacagcgtac
gaagtgcatcggaaggaagagcaagcgaccgtgaatgaagcgcgttctgaagcagcagca
gcagctgacacgactgtcatccgtgcgttcctggagaccatcgcttctttcttggatcag
acctccatcatgcagcagtcccacttggaagagtgtttcatgctcttgcgtaactgcgca
gagatcagtgccacggcgaggactcagctgcaacagctcgagatgatcgcccgcttgatc
aactttttcctatgcgatcgtggcccgagcgcgctaaaagatgcttttccttcctcgaca
ttgcaaccgacggcttcacggtatgcgtcaccagactaccagtatttactggaggctgtt
actgcaattttaggtcttccaaggcgtacaacggagccactgcttacggagaatagcaca
cagtatccccaccgcacggttctatcggagaaggctgagcaggcactaactgagattttc
gaagactaccagacaccgggaggcgcgagtggcaaccttggcttgggtctcgaagagcta
aaaaagttcttctcggtgtcactgagcagtgctactaccagtcctgcagtggagcagcag
gctcggcatatgctaaccaagtacggcacaccactggatggatttatgctgtattatacg
gatatggcagcgtcgtcgacaaagtcagtgctacaagatctccgtgctttcggtttcagt
gaggacctccagcgacactcgttatcgagcggagacgtgcccacgggagctcagattctc
gaggggctgagccctctgagccgtggtgcgctgctgaatgacgtattcttcgactcggct
cttgaggaagaggcagaaacgacgtgcgaacttttgctgcggttgagtttgggagaccac
gagacatccacgcggttgttgcgtgctcttctgcactgccttcagagcaccgaaacggga
tggaagggacaacctgtggtggacgcctgtgcactagcagtgcagcgagtgctgggttat
gagtgcgattaccagaaggaactcgtggagcttgcactggttcacagcgattacggctta
cttagctccgcgcgcagccgagagaatctgcgttcacgctacgtgaatacggcacatgtc
cctctgtttgtataccgacagttggttctggtgttggagctgcgtgcgcgcgtaccggca
gtcaattcgtggctagcagatcatcgcaacaagtgggagtggctctatgaatggctgcgt
atcgagtcattgcagcctagtctgggtggccgtctttcccaattgagacgcgagcctgca
aaactcgaaatgctgtggaggttgggtgaggcgctggggatatcctaccaggaggagcaa
cgacgatacgttgtagaaggcgctggatacgctgctgtcaacggcgtgtacgtgagcacg
tctcacgtccacgacaactgcttgacgtacgcttgtgtgaagagcgacatcgagtacaca
ctgttccgctgctgcatgcccagtaaagctcggcgctggtacatttcgtattctcctaac
aagaacctgctcggaacgatgtcggacgaagacttttactttgtccagtcgcacattgac
gacgaatctccaccggtagatggttggaaggtgtgggtgaaaaacgagaaggccaaagcg
cctgtgccaactgtgcgtctccacagctcgacggtggcggcactagatggggaaggcgac
gctgccgacgcgaccgattctgtggatggctttatggctcgaggcggcttcgatgatggc
tcgagtgccccgaccgctccttcgcctgagatggtcgtagagactgtggacgtggacgcg
gacgccgagacggtggaatatgacgacagcgaggacgaaattcgtgacagcaatgagcgc
ttccgagcggtgcatttggatacacaggaagacggcagcagcacggacgacttcatgtaa

DBGET integrated database retrieval system