KEGG   Phytophthora infestans: PITG_01456Help
Entry
PITG_01456        CDS       T01333                                 

Definition
histone acetyltransferase ESA1
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PITG_01456
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 468 aa AA seqDB search
MKATIESDDAKEDKVEAPSDGPGYPVGTTLVARWMGKTERPCVVIERTALSNDRFKYYVH
WHDFNRRMDEWINEHEIVRRGTDQETLELQEKDAKEKEKEQRAKSRSKSNAAGPGDKKQG
EPAASSPDPSSRTRGQKRKTPDDQDFTPQEEEHDEHEGMDAASIREHEEVTKVKNVRFVE
MGRFRMAAWYFSPFPKEYYPDGSIDCLHFCEFCMAFFRFKRELKLHQERRVCNRHPPGNE
IYRHEHLSVFEVDGAISKVYCQNLCYFAKLFLDHKTLYYDVDPFLFYIICEIDSRGFHPV
GYFSKEKYSELGYNLACILTFPCHQRKGYGHFIIQFSYELSKKEEKVGSPEKPLSDLGLV
SYRSYWTRELLRILQDYPEKEVSIMELTRMTSIKNEDIIATLQHLNMIKYLGGQYVYVVP
RQIVDAHLTKLTKKGPQVVPEKLHWAPLHLDIKRDKWSLKAMTADKED
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaacaatcgaaagtgatgacgctaaggaagataaggtggaggcgcctagcgac
ggcccgggctaccctgtggggaccacactggtggcacgctggatgggcaagacggagcga
ccatgtgtcgtgatcgagcgcacggcgctgagcaacgatcggttcaaatactacgtgcac
tggcatgatttcaatcgccgtatggacgaatggatcaacgagcacgagatcgtgcgccga
ggcaccgaccaagagacgctcgagctgcaggagaaagacgccaaagagaaggagaaggag
cagcgcgccaagagccgcagcaagagcaacgcagccggtcctggagacaagaagcaagga
gaacccgcagcttcaagtccagatccctcctctcgtactcgaggacagaagcggaagacg
ccagatgatcaggatttcacccctcaagaagaagaacatgacgaacacgaaggcatggac
gccgccagcattcgagagcacgaggaggtcactaaagtcaagaatgtgaggttcgtggag
atgggacgctttcgcatggcagcttggtacttctctccgttcccgaaggagtattatcct
gatgggtcgatcgattgtctgcacttctgcgagttctgcatggcatttttccgcttcaaa
cgagagctcaaattgcaccaagagcgtcgagtgtgcaaccgccacccgccaggcaacgaa
atctaccgacacgaacatctgagcgttttcgaggtggatggcgcgatttccaaagtttac
tgccagaatctctgctacttcgccaaattgtttctggaccacaagacgctttactacgac
gtggacccgttcctgttttacattatttgtgaaatcgactcgcgcggtttccaccccgtg
ggttatttctccaaggaaaagtactccgagctggggtacaacctggcttgtatccttacg
ttcccatgccatcaacgcaaaggttacggccactttatcatccagttctcctacgaactg
agcaagaaagaagagaaggtgggatcgccggaaaagcctctgtcggatcttggactcgtg
agttatcgcagctactggacgcgcgaactcttgcgtattctacaggattatccggaaaag
gaagtatcgatcatggagcttactcggatgacatctatcaagaacgaggacattatcgcg
acgctgcagcacctcaacatgatcaagtacctaggcggacagtacgtgtacgtggttcca
agacagatcgtggacgcgcacctgacaaagctgacgaagaagggtccacaggtcgttccg
gagaagctgcactgggctccgctgcacctggacatcaaacgcgacaagtggtcgctaaaa
gcaatgacagcagacaaggaggattag

DBGET integrated database retrieval system