KEGG   Phytophthora infestans: PITG_01604Help
Entry
PITG_01604        CDS       T01333                                 

Definition
serine palmitoyltransferase, putative
Orthology
K00654  
serine palmitoyltransferase [EC:2.3.1.50]
Organism
pif  Phytophthora infestans
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Ceramide biosynthesis
Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PITG_01604
Enzymes [BR:pif01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.50  serine C-palmitoyltransferase
     PITG_01604
Amino acid related enzymes [BR:pif01007]
 Aminotransferase (transaminase)
  Class II
   PITG_01604
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 443 aa AA seqDB search
MAAEHKGYAPLLVAFENFYTKRIYHRLQDVFNRPVTGPPGAHIDLIERYSVDENKTLHNK
DGCIQHCLNLGSYNYLGFADDWMNTCSKEVFPAVKQFALASTVPPMEFGTTAVHIALEKA
LAKFIGKESAIVYNMGYATNATSIPALTGKGTLILSDALNHTSIVNGARASGASVGVFKH
NDPEHLEKVLRTKIAEGQPRTHRPWKKIIVMIEGIYSMEGEIVRLREMVDVTKKYKAYVY
VDEAHSIGALGATGRGICEYAGVDPSEIDILMGTFSKSFGGMGGYIAASEEIINFIRNSS
SGAIYATSLSPVIAQQILTALNIIAGLDGTDIGRKKIASLRDNSNYFRQKLIDMGVITLG
DFDSPVIPVMLYHMSKVGEFSRQCLKRNLAVVTVGFPATPLLLARVRFCISAAHTREDMD
TALVALKEVCDLCNIRFEKRAHS
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgagcataagggctatgcgcctctgctcgtggccttcgaaaacttctacact
aaacgcatctaccaccgccttcaggacgttttcaaccgccccgtgactggccctcccggc
gcacacattgacctgatcgagcgctactccgtggacgagaacaagacgcttcacaacaaa
gacggttgcatccagcactgcctcaacctcgggtcctacaactacttgggcttcgctgat
gactggatgaacacatgcagcaaggaggtctttcctgccgtcaagcagttcgcgctggct
tcgaccgttccgcccatggaatttggcactacggcggtgcacattgcactggagaaggct
ctagccaagttcattggcaaggagtcggccatcgtgtataacatgggctacgccaccaat
gccaccagcatcccggcgctcactggcaagggtacgctcatcctgagtgacgcactgaac
cacacttccatcgtcaacggtgcgcgcgcgtccggtgcctcggtcggtgtgttcaagcac
aacgaccccgagcacctggagaaggtgctgcgtaccaagattgccgaagggcagccacgt
acccaccgcccctggaagaagatcattgtgatgatcgagggcatttactccatggaggga
gagatcgtgcgtcttcgcgaaatggtggacgtgaccaagaagtacaaggcgtacgtctac
gtggacgaggcgcacagcattggcgctctgggtgctactggccgtggtatctgtgaatat
gctggcgtggaccccagcgagatcgacatcttgatgggcacgttctccaagagttttggt
ggcatgggcggatacatcgcagcgtcagaggaaatcatcaacttcatccgcaactcgagc
tccggtgcgatctacgcgacgagtctgtctccagtaatcgcgcagcagattctgacggct
ctcaacatcattgccggtctggatggcacggatatcggtcgtaagaagattgcgtctctg
cgtgacaacagcaattatttccgtcagaaactgatcgacatgggcgtgatcactcttggg
gacttcgactcgcctgtgatcccagtcatgctgtatcacatgtcgaaggtcggggagttc
tctcgccagtgcttgaagcgtaacttggctgtggtgacggtcggtttccctgcgacgccg
ctgctgctcgctcgtgttcgtttctgcatctctgctgcccacacgcgggaggatatggac
acggctctggtggcgctgaaggaggtctgcgacctgtgcaatatccgcttcgagaagaga
gctcattcttag

DBGET integrated database retrieval system