KEGG   Phytophthora infestans: PITG_01897Help
Entry
PITG_01897        CDS       T01333                                 

Definition
histone deacetylase, putative
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pif  Phytophthora infestans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 461 aa AA seqDB search
MASATKKRVSYFYHPEEGHFYYGPGHPMKPHRMKLAHHLVVNYDLYRKMDIFEPHIASAE
EIKAFHAPDYIDFLQRISPSNQKDLTSELQKYNLGELTDCPVFDGIFDFCQIYSGGTLDA
VSRLNHGQCDIAINWAGGLHHAKKLEGSGFCYVNDIVLGILELLKYHPRVLYIDIDVHHG
DGVEEAFYVTDRVMTVSFHKYGDFFPGTGDIKDIGTKNGKYYAVNFPLLSGMTDESYESV
FKPVIQKVMETFCPSAVVLQCGADSLTGDRLGCFNVTTRGHGECVKFVKSFGLPMLVLGG
GGYTIRNVSRAWAYETSILLDEEVSNNIPYNDYFEFYAPNFKLHLEPDPDLENANSREYL
DECKYKIFENLRALTGAPSVQMSQAPPTHMLREEDEDAADPDARTDNDGKRQHEAEFYRD
DKDQRGNADDVADASVSAANGSTQEEGKDNTAPDVIPMDVV
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgccaccaagaagcgcgtgtcatacttctaccaccccgaagaaggccacttc
tattatggcccgggccaccccatgaagccccaccgcatgaaactggcccaccacctcgtg
gtcaattacgatctgtaccgcaagatggacatcttcgagcctcacatcgcgtcggccgag
gagatcaaggccttccacgctccagactacatcgactttttgcagagaatcagtcccagt
aaccagaaggatctgacctctgaattgcaaaagtacaacttgggcgagctgacggactgc
cccgtgttcgacggaatcttcgatttctgtcagatttattctggaggcacattagacgct
gtgagtcgcctgaaccacggacagtgcgacatcgctattaactgggcgggaggactgcat
catgccaagaagttggagggctcgggattctgctacgtgaacgacatcgtgctgggcatt
ctggagctgctgaagtaccatccacgcgtgctgtacattgatattgacgtgcatcatgga
gacggagtggaggaagccttctacgtcaccgaccgcgtcatgacggtgtcgttccacaag
tacggagactttttcccgggcacaggagacatcaaagatattggcaccaagaacggcaaa
tactatgcggttaacttcccactgctgagcggtatgaccgacgagagctacgagagcgtg
tttaaaccagtgatccagaaggttatggagacgttctgcccctcagctgtggtgctgcag
tgtggcgccgactcgctcacaggcgaccgactgggttgcttcaacgtcactacacgaggt
cacggtgaatgcgtcaagttcgtgaaaagcttcggtctgccgatgctcgtgctaggagga
ggaggctacacaatccgaaatgtatcgagagcatgggcctacgagacgtcgattctgctg
gacgaagaagtgtccaacaacattccgtacaacgactactttgagttctacgcaccgaat
ttcaagctgcatctggaacccgatccagatctagaaaacgccaattccagggaatatctg
gacgagtgcaagtataaaatctttgagaatcttcgtgctctaactggagccccgagtgtt
cagatgagtcaagcacctcccacgcacatgttacgggaagaggacgaagacgcagcagac
cctgacgcacgaaccgacaatgacggcaagcgacagcacgaggcggaattctatagagac
gacaaggaccagcgcgggaatgcagacgacgtagcagatgccagcgtcagtgcagccaac
ggttctactcaggaggaaggaaaggacaacacggcgccggacgtcatcccgatggatgtg
gtctag

DBGET integrated database retrieval system