KEGG   Phytophthora infestans: PITG_02022Help
Entry
PITG_02022        CDS       T01333                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
pif  Phytophthora infestans
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pif00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PITG_02022
Exosome [BR:pif04147]
 Exosomal proteins
  Proteins found in most exosomes
   PITG_02022
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1719 aa AA seqDB search
MAQDLPITFGEVLNLSTLGVNLDYVKFGTTTMESDKFVCVCEQVNGQASVVIVDMAAGNT
VQRRPINAEAAIMNPVSKVIALRAENQLQIFNMELRAKMKSHLMNEAVVFWRWISVNTIA
LVTASAVYHWSIEGDSPPAKIFDRHANLGAGTQIISYEASADNQWMLLVGISQGEGGRIA
GNMQLYSMEKKVSQVLQGHAGAFAQMKPPGRTDDAQVLVFAGTKGSGEPMQLFIMEVGRD
RDAPGGVFRLPPAAIPFAADAQADFPVSMLVSPSDDVVYMITKMGYLFLFDAHTGKPVYR
ARVSQDTTFVTCLESKSKGMLGITRRGQLLHFAINKTKLVPYVVNTLRDSQLALALATRL
DLPGAEELYFTEFNRLVGVNDIQGAARLAAASPQGALRTPQTIQRFQNMPAQPGQPQPIL
QYFSVLLEKGTLNRMESIELARPVLMQGRGQLLQKWLSEDKLECSEELGDLVAQSDTTMA
LSVYLRAEVPEKVINCFVQRGEFDKIVAYAVQTNYRCDYTFMLQNLVRANPQGALDFAQK
LAVAENGPLVDVNAVVDIFMQVNRIQETTAFLLEALKNNRPEEGYLQTRLLEINLLGGSP
QVADAILSNNMFTHYDRPRIAALCEKAGLFQRALEHYTELADLKRVIVNTQAINHEFIVT
FFGTLTSEVSMELINALMAHNMRQNLQIVVQVATKYAEQLGGKELVEVFEKFKSFDGLYF
FLGSIVNFSQDPDLHFKYIEAATKMGQFKEVERVCRDSSVYDPVKVKEFLKESKLQDPRP
LIHVCDRYDFVEELTQYLYSNNLMKYIDVYVTKVSPQKAPIVIGKLLDLDCNEDYIKNLL
NQVAQCSVDDLCEQVEKRNRLRLLQPWLETRVAQGNTETATHNAIGKIYITLNKDPQQFL
INNQFYDSEVVGKFCEKLDPALAYLAYRRAGGACDDDLIRVTTENGLFKDLARYLVERQD
LDLWGKVLVKQEEGETESPSRRALIDQVVQTALPETTNPDEVSTTVRAFMNAELPNELIE
LLERIVLQGTDFSTNKNLQNLLILTAIKAGKEKVMDYVNRLDNFDGPEIARIAVGEQYQL
YEEGFVIYKKTNHNVEAIGVLLDYIKDNERAYEFADRCNEPEVWSRLAKAQLDQGKVHDS
LSAFIKANDASSYVDVIAAAERIDNYNELIPYLKMARNTVKEQYLDTSLIYAYAKTEKYG
DLEEFISSPNVAQIQNIGERCYDEGMYNAAKLLFQNINNNAKLAICYVRLGKFREAVDAA
TKANSVGTWKEVNYACVDVNEFRLAGLCGLHIIVHPDHLEELILHYEKRGHSTELLKLME
QGLGLEGAHAGIFTELAILYSKYLPSKLMEHIKIFHSRMNVSKILRACEKGLHWDHAVYL
YKEDGQFDNAVRTMVDHPVAFSHDLFLDCIQKVRNQEIHYKAINFYLEQHPLELVRLLQV
LTPNLDHARVVHQLRKSKNLPLVAEYLKDVQKENLSAVNEALNEILVDDEDYQALRDSVD
AYENFDQISLAQKLEKHELLEFRRIAAYLYRKNKRYPQSVKLSKADKMYKDCIDCASDSD
DPELAEDILRFFVSVHDKECFCATLFTCYKLIKPDVALELAWRHGYVDFVMPYMIQFVKN
IDDKVKVLDERTQTQQETETDAQTLDPAYGMGGMQPMLAIAPTAYNDPSAQYGMGMAPGM
NMGMGMQPNMAMGGMQQNPYASSQSSMGSNPYGNSGYQY
NT seq 5160 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagatctccccattaccttcggggaagtgctcaacctgagcaccctgggtgtg
aacctggactatgtcaagtttggcacgacgacaatggagtcggacaagttcgtctgcgtg
tgcgagcaagtgaacggccaggccagcgtggtaatcgtggatatggcagcaggcaacaca
gtgcagcgtcgtcccattaacgccgaggcagcgattatgaaccccgtgagcaaggttatc
gctctgcgggcagagaaccagctgcagatcttcaacatggagctgcgagccaagatgaag
agccatctcatgaacgaggccgtggtcttctggcgctggatttccgtcaacaccatcgct
ttagtcactgcttcagcggtgtaccattggagtatcgaaggcgactcgcccccagccaag
atctttgaccgccatgcgaacttgggcgctggcactcaaattattagctacgaagcctca
gccgacaaccagtggatgttgctggtcggtatctcgcagggagaaggcggccgtatcgct
ggtaacatgcagctgtactcgatggaaaagaaggtgagtcaagtgctgcagggccacgcc
ggtgccttcgcccagatgaagcctcctggaagaacagatgacgcgcaggtgctcgtgttc
gccggtaccaagggcagtggagagcccatgcagctctttattatggaagtcggacgtgac
cgtgacgcccccggcggcgtcttccgtcttcctccagctgcaatcccatttgctgccgat
gctcaggcggatttccctgtgtcgatgctggtgagtccgagcgacgacgtcgtgtacatg
atcacaaagatgggatacctcttcctgttcgacgcacacacgggcaagcctgtgtaccgt
gctcgtgtctctcaggacacgacgttcgtcacgtgtctagagtccaaatccaagggcatg
ctgggtattacgcgtcgtggccagcttctgcattttgcaatcaacaagaccaagctggtg
ccgtacgtggtgaacacgctgcgtgactcgcagctggctctggctttggctacgcgtctg
gatttaccaggagctgaagaactgtatttcacggagttcaaccgtctcgttggtgtcaac
gacattcaaggagctgctcgtctggctgctgcttctcctcagggcgctctgcgtacgcct
cagacgatccagaggttccagaacatgcctgcgcagcctggtcagccccagcctatcctg
cagtacttcagtgttttgctcgagaagggtacactgaacaggatggagtcaattgagttg
gctcgtcctgtactgatgcagggtcgtggccagctgctccaaaagtggctgtcagaggac
aaactcgagtgttctgaggaactaggagacctggtggcccagtcggacactacaatggct
ctctcggtgtatctgcgtgctgaagtcccggagaaagtaattaactgcttcgtgcaacgc
ggcgagttcgacaagattgtggcgtacgctgtccagaccaactaccgctgcgactacacg
ttcatgctccagaacctggtgcgtgctaaccctcagggtgctctggactttgctcagaag
ctggcagtcgccgagaacggtcctttggtggacgtcaacgccgttgtcgacatcttcatg
caggtgaaccgcatccaggagaccactgctttcctgttggaagctctgaagaacaaccga
ccggaggagggatacttgcagacgcgtctactggagattaacctgctcggaggctcgccc
caggtggctgacgctattttgtccaacaacatgttcacgcactacgacagaccgcgcatt
gctgctctttgcgagaaggctggcttgttccaacgtgctctggagcactacacggagctg
gcggacttgaagcgcgtgattgtgaacacccaggcgatcaaccacgagttcatcgtgacg
ttctttggcaccctgaccagcgaggtgtcgatggagctgatcaacgctctgatggctcac
aacatgcgtcagaacctgcagattgtggtgcaggttgctaccaaatacgcggagcagctg
ggtggcaaggaactggtcgaggtgttcgagaagttcaagtcgttcgacggcctgtacttc
ttcctgggctctatcgtgaatttctcgcaggacccggaccttcacttcaagtatattgag
gctgccacgaagatgggacagttcaaggaagtggagcgtgtttgccgtgactcttctgtg
tacgaccctgtgaaggtgaaggagttcctgaaggagtcgaagctgcaagacccgcgtccg
cttatccacgtgtgtgatcgctacgatttcgtggaggaattgacgcagtatttgtattcg
aacaacctgatgaagtacatcgacgtgtatgtgaccaaggtgagccctcagaaggccccc
attgtcatcggtaagctactggacctggactgcaacgaggactacatcaagaacctgctg
aaccaggttgcgcagtgctccgtggacgacctgtgcgagcaggttgagaagcgcaaccgt
ctgcgtcttctgcagccgtggctcgagacccgtgtggctcagggcaacacggagacggcc
acgcacaatgctatcggtaagatctacatcacgctgaacaaggacccgcagcagttcctg
atcaacaaccagttctacgactcggaggttgtgggcaagttctgcgagaaactggacccg
gcgctcgcgtacctagcttaccgtcgtgcgggaggcgcatgcgatgacgaccttattcgt
gtgaccacggagaacggtttgttcaaggatctggctcgctacttggtagagcgtcaggac
ttggatctgtggggtaaagtgctggtgaagcaggaggaaggcgagacggagtctcctagt
cgtcgtgctctgattgaccaggttgtgcagactgctcttcctgagacgacgaacccggac
gaagtgtcgaccactgtgcgtgcgttcatgaacgccgagctgccgaacgagctcattgag
ctgctggaacgcatcgtactgcaaggcacggatttctcgaccaacaagaacctgcagaac
ttgttgattctgacggctataaaggctggcaaggagaaggttatggactacgtgaaccgt
ctggacaacttcgatggcccggagatcgctcgcattgccgtgggcgagcagtaccagctg
tacgaggaaggttttgtcatctacaagaagacgaaccacaacgtggaagctattggcgtg
ctgctggactacatcaaggataacgagcgtgcctacgagtttgctgaccgctgcaacgag
cctgaagtgtggtctcgtctcgctaaggctcagttggatcagggcaaggtgcacgactcg
ttgtcggcatttatcaaggccaacgacgccagctcgtacgtggatgtcattgctgcggct
gagcgtatcgacaactacaacgagctgatcccgtacctgaagatggcgcgcaacaccgtg
aaggagcagtaccttgacacgtcgttgatttacgcgtacgctaagacggagaagtacggc
gaccttgaggagttcatctcttcccccaacgtggcgcagatccagaacattggtgagcga
tgttacgatgaaggcatgtacaacgcggccaagctgttgtttcagaatattaacaacaac
gccaagctcgctatttgttacgtgcgtctgggcaagttccgtgaggctgtggatgctgcc
acgaaggccaactctgtgggcacgtggaaggaagtcaactacgcctgtgtggacgtgaac
gagttccgtcttgctggcttgtgtggtctgcacattatcgtgcacccggaccacttggag
gagctgatcttgcactacgagaagcgcggccactcgactgaactgcttaagttgatggag
cagggccttggtcttgagggcgcacacgctggcatcttcacggagctggctatcctgtac
tccaagtatttgccgtccaagctgatggagcacatcaaaatcttccactcgcgtatgaac
gtgtcgaagatcttgcgtgcctgtgagaagggtctgcactgggatcacgccgtgtacctg
tacaaggaagacggccagttcgacaacgctgtgcgaacgatggtggaccacccggtggcg
ttctcgcacgatctgttcctggactgcatccaaaaggtccgtaaccaggagatccactac
aaggcgatcaacttttacttggagcagcacccgcttgaactcgtgcgtcttctgcaagtg
ctgactcccaacttggaccacgcacgtgttgtccaccagctgcgtaagtcgaagaacttg
ccgcttgtcgctgagtacctgaaggacgtgcagaaggagaatctgtcagctgtgaatgag
gctctgaacgagattctggtagacgacgaggactaccaggcactgcgtgactctgtggac
gcgtacgagaacttcgaccagatctcgttggctcagaagttggagaagcacgagctgctg
gaattccgtcgtattgctgcctacttgtaccgtaagaacaagcgttacccgcagtctgtg
aagctctcgaaggccgacaagatgtacaaggactgtatcgactgtgccagcgactcggac
gacccggaactggccgaagatatcttgcgattcttcgtgtctgtgcacgacaaggagtgc
ttctgtgctacattgttcacgtgctacaagctgattaagccggatgttgcgttggagctt
gcttggcgtcatggctacgttgacttcgtcatgccctacatgatccagttcgttaagaac
attgatgacaaggtgaaggtgttggacgagcgtacgcagacgcaacaggagaccgagacg
gacgcgcaaacgcttgacccggcgtacggtatgggcggcatgcagccgatgctcgccatc
gcccccacggcctacaatgacccgtcggcacagtacggcatgggcatggctcccggtatg
aacatgggcatgggaatgcagccgaacatggcgatgggaggtatgcagcagaacccgtac
gctagcagccagagcagcatgggcagcaacccgtacggcaacagtggttaccagtattaa

DBGET integrated database retrieval system