KEGG   Phytophthora infestans: PITG_02112Help
Entry
PITG_02112        CDS       T01333                                 

Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase, putative
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
pif  Phytophthora infestans
Pathway
pif00280  Valine, leucine and isoleucine degradation
pif00410  beta-Alanine metabolism
pif00640  Propanoate metabolism
pif01100  Metabolic pathways
pif01200  Carbon metabolism
Module
pif_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PITG_02112
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PITG_02112
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PITG_02112
Enzymes [BR:pif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     PITG_02112
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1 Phenol_Hydrox DUF2249
Motif
Other DBs
NCBI-GeneID: 9478650
NCBI-ProteinID: XP_002907083
UniProt: D0MVI4
AA seq 427 aa AA seqDB search
MQRVMAMRLRLLQRPVRTAAQSSAAYSTKTPEFSDIVYGQDTGVRTVQFNRPEKLNALTL
PMAIHLTQRLHKIEANKTVNAVVFSGNGGKAFCAGGDIRALADHGKDPATRHVSLDFFRH
EYRLNYLLATTEKPIISFLNGVTMGGGVGLSMHGKFVVATEKTLFAMPETAIGFFPDVGA
SFLLPRLGRRLIEGEDYVADVPKSQALKGQGLGTYLALTGERLKGHEVIGLGLATHYLPT
NEYETLVHHLTGLEFADHVPQEERDEMIHEALEELETDEAFQEIDPEYLETVESVFGALN
ENDTMEGIFERLEKLNTEWSQETLATLKKMSPLSLKVTLEQMRQGAVKTCAECFQMEYRM
ATRMMENPDFFEGVRSVVVDKDRNPKWSKRDITKVTTKEVEAFFKPLEKDQELILYPSAT
AVTEKKE
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtgtgatggcgatgcgactgcggctgctgcagcgccctgtgcgcacggcagcc
cagagcagtgccgcctactccacaaagacgccagaattctcggatatcgtgtatggccag
gatacgggcgtgcgcacagtgcagttcaaccgaccggagaagctcaacgcgctgacgctc
cccatggcgatccacctgacgcagcgtctgcacaagatagaggccaacaagacggtcaac
gccgtcgttttttctggtaacgggggtaaggctttctgcgctggtggcgacattcgcgcg
ctagccgaccatggcaaagatccagctacgcgtcacgtctcgcttgactttttccgtcac
gaataccgcctcaactaccttctggcgaccaccgagaagcccatcatttccttcctcaac
ggtgtcactatgggaggcggcgtgggtctgtcaatgcacggcaagttcgtggtggccact
gagaagacgttgtttgctatgcccgagacggccatcggttttttcccggacgtcggtgcc
tcgttcctacttccgcgtctcggacgccgtctcattgagggtgaggactacgtggctgac
gtgcccaagtcgcaggcgcttaagggccagggtctgggcacatatcttgcgctgacgggt
gagcgtcttaagggccacgaggttattggtctgggacttgctacccactacctgcccacg
aacgagtacgagacgctggtgcaccacctgacaggcctcgagttcgcagaccacgtgcct
caggaggaacgcgatgaaatgattcacgaggctctggaggaacttgagacggacgaggct
ttccaggagattgacccggagtacctcgagacggttgagtcggtgttcggtgctcttaat
gagaacgacacaatggaaggcatcttcgagcgtctggagaagctgaacacagagtggtca
caggagactctcgcgacgctcaagaagatgtcgccgctgagtctgaaggtcacgctggag
cagatgcgacagggagccgtcaagacgtgcgccgagtgcttccagatggagtaccgcatg
gctacgcgtatgatggagaacccggactttttcgagggtgtgcgttcggttgttgtggac
aaagatcgcaacccgaagtggtcaaagcgcgacatcaccaaggtgacgactaaggaggtg
gaggcgttcttcaagccgctggaaaaggatcaggagctgatcctgtacccgtccgcgacg
gcagtgacggagaagaaagaataa

DBGET integrated database retrieval system