KEGG   Phytophthora infestans: PITG_02112Help
Entry
PITG_02112        CDS       T01333                                 

Definition
3-hydroxyisobutyryl-CoA hydrolase, putative
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
pif  Phytophthora infestans
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PITG_02112
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PITG_02112
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PITG_02112
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PITG_02112
Enzymes [BR:pif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     PITG_02112
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 427 aa AA seqDB search
MQRVMAMRLRLLQRPVRTAAQSSAAYSTKTPEFSDIVYGQDTGVRTVQFNRPEKLNALTL
PMAIHLTQRLHKIEANKTVNAVVFSGNGGKAFCAGGDIRALADHGKDPATRHVSLDFFRH
EYRLNYLLATTEKPIISFLNGVTMGGGVGLSMHGKFVVATEKTLFAMPETAIGFFPDVGA
SFLLPRLGRRLIEGEDYVADVPKSQALKGQGLGTYLALTGERLKGHEVIGLGLATHYLPT
NEYETLVHHLTGLEFADHVPQEERDEMIHEALEELETDEAFQEIDPEYLETVESVFGALN
ENDTMEGIFERLEKLNTEWSQETLATLKKMSPLSLKVTLEQMRQGAVKTCAECFQMEYRM
ATRMMENPDFFEGVRSVVVDKDRNPKWSKRDITKVTTKEVEAFFKPLEKDQELILYPSAT
AVTEKKE
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtgtgatggcgatgcgactgcggctgctgcagcgccctgtgcgcacggcagcc
cagagcagtgccgcctactccacaaagacgccagaattctcggatatcgtgtatggccag
gatacgggcgtgcgcacagtgcagttcaaccgaccggagaagctcaacgcgctgacgctc
cccatggcgatccacctgacgcagcgtctgcacaagatagaggccaacaagacggtcaac
gccgtcgttttttctggtaacgggggtaaggctttctgcgctggtggcgacattcgcgcg
ctagccgaccatggcaaagatccagctacgcgtcacgtctcgcttgactttttccgtcac
gaataccgcctcaactaccttctggcgaccaccgagaagcccatcatttccttcctcaac
ggtgtcactatgggaggcggcgtgggtctgtcaatgcacggcaagttcgtggtggccact
gagaagacgttgtttgctatgcccgagacggccatcggttttttcccggacgtcggtgcc
tcgttcctacttccgcgtctcggacgccgtctcattgagggtgaggactacgtggctgac
gtgcccaagtcgcaggcgcttaagggccagggtctgggcacatatcttgcgctgacgggt
gagcgtcttaagggccacgaggttattggtctgggacttgctacccactacctgcccacg
aacgagtacgagacgctggtgcaccacctgacaggcctcgagttcgcagaccacgtgcct
caggaggaacgcgatgaaatgattcacgaggctctggaggaacttgagacggacgaggct
ttccaggagattgacccggagtacctcgagacggttgagtcggtgttcggtgctcttaat
gagaacgacacaatggaaggcatcttcgagcgtctggagaagctgaacacagagtggtca
caggagactctcgcgacgctcaagaagatgtcgccgctgagtctgaaggtcacgctggag
cagatgcgacagggagccgtcaagacgtgcgccgagtgcttccagatggagtaccgcatg
gctacgcgtatgatggagaacccggactttttcgagggtgtgcgttcggttgttgtggac
aaagatcgcaacccgaagtggtcaaagcgcgacatcaccaaggtgacgactaaggaggtg
gaggcgttcttcaagccgctggaaaaggatcaggagctgatcctgtacccgtccgcgacg
gcagtgacggagaagaaagaataa

DBGET integrated database retrieval system