KEGG   Phytophthora infestans: PITG_02212Help
Entry
PITG_02212        CDS       T01333                                 

Definition
mitogen-activated protein kinase, putative
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PITG_02212
Protein kinases [BR:pif01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   PITG_02212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 365 aa AA seqDB search
MGEEVEKHVLRKYELLQKLGKGAYGIVWKAIDKNNRQVVALKKCFDAFRNATDAQRTFRE
VMYLQELNGHSNIIRLLNVVKADNDRDIYLVFDFMETDLHAVIRANILEEIHKKYIIYQL
LKSLKYMHTAELLHRDIKPSNLLLNSDCHTKLCDFGLCRSVAEISGPNPVLTDYVATRWY
RAPEILLGSTKYAKSVDMWAVGCIVAEMATGRPSFPGTSTMNQLERILDVTGPPSQDDIE
SIKSPFANTMLESLPAPKKKALEELFPKASPDALDLIKQCFWFDPSKRISVIDALKHPYV
AQFHNEKDEPSAPAPLQIVVDDNTKYSAADYRDRLYREIIKKKKEVRRKAGEQETAAVAG
TTTTQ
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaagaagtcgagaaacatgtgctgcgcaagtacgagctgctgcagaagttaggc
aaaggcgcgtatggcattgtgtggaaggccatcgacaagaacaatcggcaggtagtggct
ttgaaaaagtgtttcgacgcattccgcaatgcgacagatgcgcagcgcacatttcgcgaa
gtcatgtacttgcaagagctgaacggacacagcaacattatccgcttgctgaatgtcgtc
aaagctgacaacgaccgcgatatctacctcgtgttcgactttatggaaacggacttgcat
gctgttatacgagccaatatcttagaggagatccacaagaagtatatcatctaccagttg
ttgaagtcgcttaagtacatgcatacagccgagctgctgcaccgcgacatcaagccgagc
aatctacttcttaactcagactgccacaccaaactctgcgactttggactttgccgttcc
gtggccgagatcagcggacccaatccagttctcacagattacgtcgctacccgatggtac
cgtgctccagaaattttgctgggctcgacaaagtacgccaagtcagtggatatgtgggct
gtcggctgtatcgtggcagaaatggccactggacgaccttctttcccaggcacatcgacc
atgaatcaacttgagcgtatcctggatgtcaccggcccaccgtctcaagacgatattgaa
agtatcaagtcaccgttcgccaatacgatgctggaaagtctgcctgcaccaaagaagaaa
gcgttggaggaactctttcccaaggcctcgccagatgcactcgatcttatcaaacaatgc
ttctggttcgatccgtccaagaggatctcggtcatcgacgcgttgaaacacccgtacgtg
gcacagttccataacgagaaggacgagcccagtgctccagctcctttgcagatagtagtt
gatgacaataccaaatattccgccgctgactatcgcgaccgcctctaccgtgagatcatc
aagaagaagaaagaggtccgacggaaagcaggcgaacaggagacggccgctgtggctggt
acaaccaccacgcagtag

DBGET integrated database retrieval system