KEGG   Phytophthora infestans: PITG_02429Help
Entry
PITG_02429        CDS       T01333                                 

Definition
cAMP-dependent protein kinase catalytic subunit, putative
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PITG_02429
Protein kinases [BR:pif01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   PITG_02429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 330 aa AA seqDB search
MATPDGVKVSNKFAAPLDGSQFDMGVTLGTGSFGRVRFATHKATNTYWAIKILKKAEIIR
LQQVEHMLSEKSILLCLDHPFIVNLAGTFQDTKYLYMVLEYVIGGEFFTHLRKAGRFDNN
TAKFYAAQVVSIFEYMHSQDFIYRDLKPENLLLDNEGYIKITDFGFAKRVAFKTYTLCGT
PEYIAPEVLLNKGHGKGVDWWTLGILLYEMLAGQPPFCDDDPMGIYQQILSGKLNFPRFF
DRNAKGLIKRMLTADLTKRYGCLKNGVEDIKKHKFFTGINWEDLLARKGAAPIIPRVGTA
NDTSNFDPYPDSMEDAIVPVYNGKDPFAEF
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccagacggcgttaaggtctcgaacaagtttgccgccccactcgatggctcg
caattcgacatgggtgtgacgctaggtaccggctccttcggtcgtgtgcgcttcgctacc
cataaagcaaccaacacgtactgggctatcaagatcttgaaaaaggcagagatcattcgg
ctgcaacaggtcgagcacatgctctcggaaaagtccatcttgctatgtttggaccatcca
ttcattgtcaacttggcaggcacgtttcaggacaccaagtacctgtacatggtgctcgag
tatgtcatcggtggcgagttcttcacgcaccttcgaaaggctgggcggttcgacaacaac
acggcaaagttttacgcagcacaggtggtatccatcttcgagtacatgcatagtcaggat
ttcatctaccgcgacttgaagcccgagaacttgctactagacaacgagggctacatcaag
atcactgacttcgggttcgccaagcgagtggcgttcaagacgtacacgctttgtggcaca
cccgagtacatcgcgccagaggtgctacttaacaaggggcacggcaagggagtggactgg
tggacactgggcattttgctgtacgaaatgctggcaggacagccaccattctgcgacgac
gaccccatgggcatttaccagcaaattctttcaggaaagctcaacttcccgcgtttcttc
gaccgaaacgccaagggacttatcaaacgcatgctcacagccgaccttacgaaacggtac
ggttgtctcaagaacggagtggaggacatcaagaaacacaagtttttcaccggtatcaat
tgggaggacctgctcgcgcgcaagggcgccgcaccgattatcccacgtgtcggcacggcc
aacgatacgtccaatttcgacccatacccggactccatggaggatgcgattgtccccgtt
tacaacggcaaagatccctttgccgagttttag

DBGET integrated database retrieval system