KEGG   Phytophthora infestans: PITG_02429Help
Entry
PITG_02429        CDS       T01333                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit, putative
Organism
pif  Phytophthora infestans
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 330 aa AA seqDB search
MATPDGVKVSNKFAAPLDGSQFDMGVTLGTGSFGRVRFATHKATNTYWAIKILKKAEIIR
LQQVEHMLSEKSILLCLDHPFIVNLAGTFQDTKYLYMVLEYVIGGEFFTHLRKAGRFDNN
TAKFYAAQVVSIFEYMHSQDFIYRDLKPENLLLDNEGYIKITDFGFAKRVAFKTYTLCGT
PEYIAPEVLLNKGHGKGVDWWTLGILLYEMLAGQPPFCDDDPMGIYQQILSGKLNFPRFF
DRNAKGLIKRMLTADLTKRYGCLKNGVEDIKKHKFFTGINWEDLLARKGAAPIIPRVGTA
NDTSNFDPYPDSMEDAIVPVYNGKDPFAEF
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccagacggcgttaaggtctcgaacaagtttgccgccccactcgatggctcg
caattcgacatgggtgtgacgctaggtaccggctccttcggtcgtgtgcgcttcgctacc
cataaagcaaccaacacgtactgggctatcaagatcttgaaaaaggcagagatcattcgg
ctgcaacaggtcgagcacatgctctcggaaaagtccatcttgctatgtttggaccatcca
ttcattgtcaacttggcaggcacgtttcaggacaccaagtacctgtacatggtgctcgag
tatgtcatcggtggcgagttcttcacgcaccttcgaaaggctgggcggttcgacaacaac
acggcaaagttttacgcagcacaggtggtatccatcttcgagtacatgcatagtcaggat
ttcatctaccgcgacttgaagcccgagaacttgctactagacaacgagggctacatcaag
atcactgacttcgggttcgccaagcgagtggcgttcaagacgtacacgctttgtggcaca
cccgagtacatcgcgccagaggtgctacttaacaaggggcacggcaagggagtggactgg
tggacactgggcattttgctgtacgaaatgctggcaggacagccaccattctgcgacgac
gaccccatgggcatttaccagcaaattctttcaggaaagctcaacttcccgcgtttcttc
gaccgaaacgccaagggacttatcaaacgcatgctcacagccgaccttacgaaacggtac
ggttgtctcaagaacggagtggaggacatcaagaaacacaagtttttcaccggtatcaat
tgggaggacctgctcgcgcgcaagggcgccgcaccgattatcccacgtgtcggcacggcc
aacgatacgtccaatttcgacccatacccggactccatggaggatgcgattgtccccgtt
tacaacggcaaagatccctttgccgagttttag

DBGET integrated database retrieval system