KEGG   Phytophthora infestans: PITG_02546Help
Entry
PITG_02546        CDS       T01333                                 

Definition
ubiquitin carboxyl-terminal hydrolase, putative
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PITG_02546
Peptidases [BR:pif01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PITG_02546
Exosome [BR:pif04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PITG_02546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 854 aa AA seqDB search
MTKASLSSAASLVRVARASDRVYRDECIFSFDSALSPSGLYTNLRSFLSYGASYLVFDRS
ETPAVYLHQQHTRKPKASSSSSTEEIPTKLAIGGAGGFAASVKDKFELEKTFYIVSLGPD
QHELAREALDSPSLPSKLKEAAEAVLSHAGNTVTEEVASWQEELEPTKYAEHLIQVPNPP
HIASNPSAWKCQAADCDKQENLWLNLSDGYIGCGRQNWDGSGGCGAALTHFSETGGIYPL
SVKLGTITAEGGDVYSYAPDEDDMVKNSLLPNHLEHFGINVNNLKKTDKSMNELQVGLNL
SYEFDAVTEAGMKLVPVSGAGYMGFKNLGNSCYMNSVLQLLLALPEVQERYFKVSKKIFS
TADTLPVDDFAAQFAKLTCATLTDRYKKQFVTPKNSNKEIEEDEIHNVDLRPITFRGLVG
KGHPDFSTGQQQDAVEYLQHLLDFMTRAERVGASRLGPLLPGDSATSAELPTASLFKFKL
EDRVQCMASNKVKYVPRDDMLLQLQIPLEAATNATQVNAYQVLEQKRQRLGDEKREKSEK
EGEERVVPNVPFEACVEKTLAPEVIEDFLSPATGKKGQAQKTVRFRSFPRYLLVQMRRFY
VAEDWTPKKLEVEVKVPEHFSLSRFISKGLVDGEEELPEASTASGTTESSASASVDADEV
LVAQLVSMGFSENGCKRAAIATGNSNAEAAMEWIFSHMEDPDFNDPPASADAAVKDEDDA
VNMEHVSNLMAMGFGEPHAKCALKQTDNNPDRAAQWLFSHMDDLDGAVAQCESESAVSSG
DSGSSVMRLDSESTGDYSLVGFVSHVGKNTNSGHYVCHMKKDGRWIIFNDDKVAVSEEPP
LGAGYLYLFRRADA
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagcttctctatcctccgcggcttcgcttgttcgcgtggcacgggcttcggat
cgcgtgtaccgtgacgagtgcattttctccttcgactccgctctctccccctcgggtctc
tacacgaacctgcgctccttcctctcgtacggagcctcgtatcttgtgttcgatcgcagc
gaaactccggccgtctacctgcaccagcagcacacacgcaagcctaaggcttcatcctct
tcaagtaccgaagaaatccccacaaagctcgctattggtggcgctgggggcttcgcagcg
tccgtaaaagacaaattcgagcttgaaaagactttctatatcgtttcactgggcccagac
cagcatgaactcgcccgggaagctctagactcccccagtctcccgtctaagctcaaagaa
gcagccgaggctgtgctcagtcacgcggggaacacggtaaccgaagaagtagcgtcctgg
caggaggaactcgagcctaccaagtacgccgaacacctcattcaagtcccgaacccaccg
cacattgcgtcgaacccttcggcgtggaaatgtcaagcagcagactgtgataagcaggag
aacttgtggctcaacttgtcagatggctacattggttgtggtcgtcagaactgggacgga
tctggaggttgtggggcagcattgacccatttcagtgagactggaggaatttacccatta
tccgtgaaattgggcacaattacagctgaagggggagacgtgtacagctacgcaccggac
gaagatgatatggttaagaactccttgttaccgaaccatttggagcactttggcatcaat
gttaacaacttgaagaagacggacaagtcgatgaatgagctgcaagtgggactgaatttg
tcgtacgagtttgacgcagttaccgaagctggtatgaagctggtaccggtttcaggtgcg
ggatatatggggttcaagaatctgggcaatagctgctacatgaactcggtgctgcagctg
cttctggcactccctgaggtgcaggagcggtattttaaggtgtcgaagaagattttctcg
actgcagacacgctgccagtggacgatttcgctgctcagttcgctaaactcacgtgtgcg
acgttgacggatcgctacaagaagcagtttgtgacgccgaagaacagcaacaaggagatc
gaagaggatgagatccataatgtcgatctcagaccaatcacgttccgtggtcttgtgggg
aaaggccatcccgatttctctacgggacagcagcaagatgcagtggagtatctccagcat
ttgctggattttatgactcgagctgagcgtgtcggtgcgagtcgcttggggccgcttctt
cctggagatagcgcgacgagtgcggagctgccaactgcaagcttgttcaagtttaaactg
gaagaccgggtgcagtgcatggcgtcgaataaggtgaagtatgtgccacgtgatgacatg
cttcttcaattgcaaattcccctcgaggcagcaaccaatgccacccaagtgaacgcttac
caggtgcttgaacagaagcgccagcgtcttggagacgagaagagagaaaagagtgagaag
gaaggagaagaacgcgtcgtgcctaatgtcccgtttgaagcgtgtgttgaaaagacgctg
gcaccggaagttattgaagacttcttgtcccctgctactggcaagaagggtcaagcacag
aagacggttcgcttccgctcctttccgcgctacttgctcgtgcaaatgagacgcttttac
gtagctgaagactggacgcctaagaagctggaagttgaagtgaaggtgccagaacatttt
tctctcagtcggttcatctcaaagggtctcgtcgacggcgaagaggaactacccgaggcg
tctactgcaagtggaacgactgagagcagtgctagtgcttcagtagatgccgacgaagtc
ctcgtggcccagttggtgtccatggggttctcggagaatggatgtaaacgtgctgctatc
gccactggcaactccaacgctgaagctgcgatggagtggatctttagccacatggaagac
ccggattttaacgaccctcctgcctcggcagatgccgctgtgaaggatgaagatgacgcc
gttaacatggagcacgtgtctaatctaatggcgatgggcttcggtgagccgcacgccaag
tgtgctctcaagcagaccgacaacaacccggaccgcgccgctcagtggctgttcagtcac
atggacgatctggacggtgctgtggctcaatgtgagagcgaatcagcggtgtcaagtggt
gattcgggatcttctgtgatgcgtttggatagcgagagtactggagactattctcttgtg
ggctttgttagccacgtgggcaagaacaccaactcgggacattacgtgtgtcacatgaag
aaggatggtcgctggattatctttaatgatgacaaggtggctgtgtcggaggaacctcct
cttggcgctggatatttgtacctgttccgacgcgcagatgcttag

DBGET integrated database retrieval system