KEGG   Phytophthora infestans: PITG_03328Help
Entry
PITG_03328        CDS       T01333                                 

Definition
anaphase-promoting complex subunit, putative
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
pif  Phytophthora infestans
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:pif00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    PITG_03328
Protein phosphatases and associated proteins [BR:pif01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     PITG_03328
Ubiquitin system [BR:pif04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     PITG_03328
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 644 aa AA seqDB search
METALVGQVQRYLDLYVYDNARFLAERLVAHHPSEENALLLASCYYRKGQVDRAVEVLSG
ATRAENRYLLARCCFQQNKLVEAENALLGGEKCHIDELDAIENVPAGAAGLYLLGRVCRR
GNRRQQAVACFIKSLEIDPFMWSAYEELCELGANLEASRFFGTANYFHSSESQFGDEDDN
NAEDRPTDESFGTPEPPPFFGLGTPKNVLSSEPNTSRPLAYKTPNVNNNNNGNDIHTATV
VKKPRVEDVGAPLRQRKAYRRPLADSDEKYRPNARLSFSAAAFDDSPLNPSKLSLGSPTS
PLPTRRLYQDKTLLLRLLTSFGSIYQKVSMYMCGEALEMLEQLPASQRASGWAQQQIGRA
YFEMADYVQAQEVFCALHRAEPHRMDGLDLYSTTLWHLKKEVELSYLAQQATDFDKLSCE
AWCVAGNCFSLQKEHDTALAFFQRAIQLDPSFTYAYTLSGHEYVANEDFEKAVNCYRHAI
RTDSRHYNAWYGLGTIYYRQEKFEFAEYHFKRALEINPRSSLLHCFLGMVLHATHRYDDA
LATLAVAAELQPLNPQARFQRANVLITLQQYEEALEELHVVKNFAPRESSVHFMMGKVAK
KLGRIEEAMKYFILALHFHPKDNNQIKVAIDKINEPDHEDDDRM
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggagacggcgctggtgggccaggtgcagcgctacctggacctttacgtgtacgacaac
gcgcgttttctagcagagcggctcgttgcacatcatccgagcgaggagaacgcgctgcta
ctagcctcgtgctattatcgcaaaggccaagtggatcgagctgtggaagtgctgagtggc
gcgacgcgagctgaaaaccgctatctattagcacgctgttgctttcagcagaataagctg
gtcgaggctgagaacgcgttgctaggaggcgagaagtgccacatcgatgaacttgacgca
attgagaacgtgccagcgggcgctgctggcctgtatttgctgggccgagtctgcagacgt
gggaacaggaggcaacaggctgtggcgtgcttcataaagagtttggagatagatccgttc
atgtggtcggcttacgaggaactgtgcgagcttggagctaatcttgaggcttccaggttt
ttcggcacggcgaattacttccacagctccgaatctcaatttggcgacgaagacgataac
aatgctgaggatcgtcctacagacgaatcattcgggaccccagagccaccaccgtttttt
ggcctcggcacgccgaaaaatgtgctatcctcggaacctaacacatctaggccgttggct
tataagacgccgaatgtaaacaacaacaacaacgggaacgacatccacactgcgacggtt
gtcaagaagccacgagtagaagacgtcggagctcctctacgccagaggaaagcgtaccga
cgacctctagcggacagtgacgaaaagtaccgacctaatgcaagactgtcgttctctgct
gccgcattcgacgattctccactgaatccatcaaaactatcgcttggctctccaacatct
ccattgcccactcgacgcctttaccaggacaagacactgctactgcggttgctcacctcg
tttggttctatttatcagaaagtcagcatgtacatgtgtggcgaagctctggagatgctg
gagcagcttcccgcctcccagcgtgcatccggttgggcacagcagcagatcggaagagca
tatttcgaaatggccgactacgtacaagcacaagaagttttctgtgccttacacagagcg
gagccgcatcgaatggatggtcttgacttgtactcgacaacattgtggcatctcaagaag
gaggtggagctttcgtatctcgctcaacaagcgacggactttgataaattatcgtgtgaa
gcttggtgtgtggctggaaactgtttcagcttgcaaaaggagcacgatacagcgttagcc
ttctttcagcgggcaattcaactggacccgtcgttcacatacgcgtacacactgtccggt
cacgagtatgttgccaatgaggattttgagaaggctgtcaactgctatcgacatgccatt
cgtactgattcgcggcattataatgcctggtatggtctgggcacgatctactaccgacaa
gagaaatttgagttcgctgagtaccatttcaagcgcgctttggagatcaatccgcgcagt
tcgctgcttcactgcttccttgggatggttctccatgcaacccaccgctatgacgacgcg
ctagccacacttgcggtcgccgcggagttacagccgctgaatcctcaagctcgattccag
cgtgccaatgtactgatcacactgcaacagtacgaagaggctctggaggagcttcatgtt
gtcaagaattttgcgccgcgtgagtcgtccgtgcatttcatgatgggcaaagtggccaag
aaacttgggcggatcgaggaagccatgaagtatttcatcttggcgctgcacttccaccct
aaggacaacaaccagatcaaggtagccatcgacaaaatcaacgagcctgaccatgaggac
gatgacagaatgtag

DBGET integrated database retrieval system