KEGG   Phytophthora infestans: PITG_03440Help
Entry
PITG_03440        CDS       T01333                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pif  Phytophthora infestans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PITG_03440
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PITG_03440
   00630 Glyoxylate and dicarboxylate metabolism
    PITG_03440
Enzymes [BR:pif01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PITG_03440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 535 aa AA seqDB search
MSELNVNAANVRVLGHVSDAFRRVLTPDALRFLAFLHEQFEPRRQALLAARVQRQKELDA
GVLPDFLPETAYIREGDWKVASIPADLADRRVEITGPVDRKMVINALNSGSKCYMADFED
STAPTWFNQVDGQVNLIDAARKTISYTHPQTGKKYALNDKVATLLVRPRGWHLDEAHVLV
NNQIMSGSLFDFGLYFFHNAHELLARGSGPYFYLPKLEHHLEAKLWNDVFVAAQSYLSIP
QGSIRATVLVETIVAVFQMDEILYELRNHSSGLNCGRWDYIFSYIKKFRNHPKFVVPDRS
SVGMTTPFMAAYVKLLVRTCHRRGAHAMGGMAAQIPVKNDPELNNKFMAAVTEDKSREVT
AGHDGTWVAHPGLVKIAMDAFSKMSGPNQISFIPEVGKDITAAQLIEPPTGAITYNGLVE
NIDVSLVYTEAWLRGSGCIPLHNKMEDAATAEISRAQVWQWIRHSCKTVEGKTVTKDLVL
DILKECVNKRSLNAPPGNKWALGGEIMGKVLTGDDMVDFLTLPCYPRIVQLGSSI
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagctcaatgtcaacgccgccaacgtccgcgtgctgggccacgtctcggatgcg
ttccgccgcgtactcacgcccgatgcactacgcttcctcgccttcctgcatgagcagttc
gagccacggcgacaggcactgttggctgcgcgtgtacagcgtcagaaggagttggatgcc
ggtgtgctgccggacttcctgcctgaaaccgcctacatccgcgaaggcgactggaaggtg
gcatctatccccgctgacctggctgaccgccgcgtcgagatcacgggccctgtggaccgc
aagatggttattaacgcgcttaactctggttccaagtgctacatggccgactttgaggac
tcgacggcccccacgtggttcaaccaggtggacggccaggtaaacctcatcgatgcagcg
cgcaagaccatttcgtacacgcacccgcagacaggcaagaagtacgcgctcaacgacaag
gtggcaacgctgctggtgcgtccgcgtggctggcatctggacgaggcccacgtgcttgtg
aacaaccagatcatgtctggatcgctcttcgacttcggcctctacttcttccacaacgca
cacgaactgctggcgcgtggctcgggtccgtacttctacctacccaaactagagcaccac
ctagaagccaagctgtggaacgacgtgttcgtggccgcccagagctatctgagcattccg
cagggttccatccgcgcgactgtgctggtggagaccatcgtggctgtcttccagatggac
gagatcctgtatgagttgcgcaaccactcgtcgggtctcaactgtggtcgatgggactat
atcttctcgtacattaagaagttccgcaaccaccccaagttcgtggtgccggatcgctca
tcggttggtatgaccacaccgttcatggccgcctacgtcaagctgctcgtccgcacgtgc
caccgtcgtggcgctcacgctatgggcggcatggcggctcagatccccgtcaagaacgac
ccggagctcaacaacaagttcatggctgccgtcacggaggacaagtcgcgtgaggtgact
gcgggtcacgacggcacgtgggtggcgcatccgggtctcgtcaagattgccatggacgcg
ttcagcaagatgtcgggtccgaaccagatctcgttcatccctgaggtcggcaaggatatc
actgcagctcagctcatcgaacccccgacgggtgctatcacgtacaatggtctggtggag
aatattgacgtgtcgctcgtgtacacggaggcgtggcttcgtggcagtggctgtatcccg
ctgcataacaagatggaggacgctgctacggccgagatctcgcgtgcacaagtctggcaa
tggattcgtcacagctgtaagacggtggagggcaagaccgtgacgaaggatttagtgctg
gacatcctgaaggagtgtgtcaacaagcggtcactgaatgcccctccgggcaacaagtgg
gcgctcggaggcgagatcatgggcaaggtgctgacaggagacgacatggtggacttcctc
acgctgccgtgctacccgcgcattgtgcagctcggatcgagcatctga

DBGET integrated database retrieval system