KEGG   Phytophthora infestans: PITG_03550Help
Entry
PITG_03550        CDS       T01333                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
pif  Phytophthora infestans
Brite
Exosome [BR:pif04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PITG_03550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 115 aa AA seqDB search
MAKTPSKKAAKTVAKSGKGKGKKRVESYSTYIYKVLRQVHPDTGISKRGMSIMNSFINDI
FERIASEAGKLSRYNKKSTLSSREIQTAVRLMLPGELAKHAVSEGTKAVTKFTSA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagactccctccaagaaggccgcaaagacggttgccaagtccggcaagggcaag
ggcaagaagcgtgttgagtcgtactcgacctacatctacaaggtgctgcgtcaggtgcac
cctgacacgggtatcagcaagcgcggcatgtcgatcatgaattcgttcatcaatgacatt
ttcgagcgcatcgcttcggaggccggcaagctgtcccgctacaacaagaagtccacgctt
tccagccgtgagatccagactgccgtgcgcctcatgctccctggtgagcttgccaagcac
gccgtgtcggagggcacgaaggctgtgaccaagttcacgtcggcttaa

DBGET integrated database retrieval system