KEGG   Phytophthora infestans: PITG_03598Help
Entry
PITG_03598        CDS       T01333                                 

Definition
(RefSeq) 6-phosphofructokinase, putative
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pif  Phytophthora infestans
Pathway
pif00010  Glycolysis / Gluconeogenesis
pif00030  Pentose phosphate pathway
pif00051  Fructose and mannose metabolism
pif00052  Galactose metabolism
pif01100  Metabolic pathways
pif01110  Biosynthesis of secondary metabolites
pif01130  Biosynthesis of antibiotics
pif01200  Carbon metabolism
pif01230  Biosynthesis of amino acids
pif03018  RNA degradation
Module
pif_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PITG_03598
   00030 Pentose phosphate pathway
    PITG_03598
   00051 Fructose and mannose metabolism
    PITG_03598
   00052 Galactose metabolism
    PITG_03598
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PITG_03598
Enzymes [BR:pif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PITG_03598
Protein phosphatases and associated proteins [BR:pif01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PITG_03598
Messenger RNA biogenesis [BR:pif03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PITG_03598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-GeneID: 9467550
NCBI-ProteinID: XP_002906655
UniProt: D0MY08
AA seq 504 aa AA seqDB search
MSFRRESVDSSAAAFQVRHKAAPFASKHPKGFGEMVLVDGVSIEKTYLLPVPNLREWLPE
HDNQVCNRRKLDTQADDSVERKSTYNKIMGETDVILGDIRRNDSQEAVSRAYVRAGPRGN
TYFDPAKVKAAAVTCGGLCPGLNNVVRDVTLALWNLYGVRDIYGIRMGFAGFYNWTSMDQ
KEAPIMLTPKSVASIHHHGGTILGSNRGGFDQDKIIDFMTTHGVSQLYVIGGDGTHRAAN
KISEECRRRKLAIAVAGVPKTIDNDVDLLDRSFGFNTAVEEAQRAIRSASTEARCVPNGI
GVVKLMGRSAGFIAAHASLSSGDVNLCLIPEIPIELEGPRSCLDHLEHVVEEQGHGVVVV
AEGAGEELLGTSVEADAGGNKKLPPIGAFMKDRIQEHFTKKGKECTVKYIDPSYMIRSVP
ANAADSLYCMLLGQNAVHGAMAGYTGFTVGLSANRVVYFPIEAITRNSPRCMDPFGRTWE
RVLCLTRQPNTAREGDIKGAKSSD
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgagtttccgtcgcgagtccgtggactcctcggccgcggccttccaggtcagacacaag
gctgcccctttcgccagcaagcaccccaaagggttcggcgagatggtgctggttgacggc
gttagtatcgagaagacgtatctgctacctgtgccgaaccttcgcgagtggcttcctgag
catgacaaccaagtctgcaaccgccgcaaactcgacacgcaagctgatgactcggtcgaa
cgtaagagcacttacaacaagatcatgggcgagaccgacgtgatcctgggcgatatccgc
cgcaatgactcgcaggaggccgtttcgcgcgcttatgtgcgtgctggtccgcgcgggaac
acgtatttcgaccccgccaaggtcaaggccgctgctgtgacctgcggtggtttgtgcccg
ggcctgaacaatgttgtgcgcgatgtgaccctcgccttgtggaacctgtacggtgtccgc
gacatctacggtatccgcatgggcttcgccggcttctacaactggacctcaatggaccag
aaggaggcccccattatgctgacccctaagagcgtagctagcatccaccaccacggaggc
acgatcctcggctctaaccgtggcggcttcgaccaggacaagatcatcgacttcatgact
acgcatggcgtctcgcagctctacgtgattggcggtgatggtactcaccgtgctgccaac
aagatatcggaggaatgccgtcgccgcaagctggcaatcgctgttgccggtgtgcctaag
accatcgataacgatgttgatcttctggaccgcagcttcggttttaacactgccgtcgag
gaagcccagcgtgccattcgctcggccagcacggaggctcgttgcgtgcccaacggtatt
ggggttgtcaagctcatgggccgtagcgccggtttcattgccgcacacgcctcgctctcc
agtggtgacgttaacctgtgcctgatccccgagattccgatcgagctggaaggcccccgc
agctgcctggaccaccttgagcacgttgtggaggaacaaggtcatggtgtggtcgtcgtc
gctgagggcgctggtgaagagctgctaggcacgtcggtggaggcagatgccggcggcaac
aagaagctcccgcctattggcgctttcatgaaggaccgcatccaggaacacttcaccaag
aagggcaaggagtgcaccgtcaagtacattgacccctcgtacatgattcgctccgtgcca
gccaacgccgccgacagtctgtactgcatgctgctgggccagaacgccgtacacggcgct
atggccgggtacaccggtttcacggtcggccttagcgccaatcgtgtcgtgtacttcccc
attgaggccatcacacgcaactcaccgcgctgcatggaccccttcggtcgcacgtgggag
cgtgtgctgtgcctgacgcgccagcccaacacggctcgcgagggagacatcaagggcgcc
aagtcttctgactaa

DBGET integrated database retrieval system