KEGG   Phytophthora infestans: PITG_03598Help
Entry
PITG_03598        CDS       T01333                                 

Definition
6-phosphofructokinase, putative
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pif  Phytophthora infestans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PITG_03598
   01230 Biosynthesis of amino acids
    PITG_03598
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PITG_03598
   00030 Pentose phosphate pathway
    PITG_03598
   00051 Fructose and mannose metabolism
    PITG_03598
   00052 Galactose metabolism
    PITG_03598
Enzymes [BR:pif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PITG_03598
Protein phosphatases and associated proteins [BR:pif01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PITG_03598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 504 aa AA seqDB search
MSFRRESVDSSAAAFQVRHKAAPFASKHPKGFGEMVLVDGVSIEKTYLLPVPNLREWLPE
HDNQVCNRRKLDTQADDSVERKSTYNKIMGETDVILGDIRRNDSQEAVSRAYVRAGPRGN
TYFDPAKVKAAAVTCGGLCPGLNNVVRDVTLALWNLYGVRDIYGIRMGFAGFYNWTSMDQ
KEAPIMLTPKSVASIHHHGGTILGSNRGGFDQDKIIDFMTTHGVSQLYVIGGDGTHRAAN
KISEECRRRKLAIAVAGVPKTIDNDVDLLDRSFGFNTAVEEAQRAIRSASTEARCVPNGI
GVVKLMGRSAGFIAAHASLSSGDVNLCLIPEIPIELEGPRSCLDHLEHVVEEQGHGVVVV
AEGAGEELLGTSVEADAGGNKKLPPIGAFMKDRIQEHFTKKGKECTVKYIDPSYMIRSVP
ANAADSLYCMLLGQNAVHGAMAGYTGFTVGLSANRVVYFPIEAITRNSPRCMDPFGRTWE
RVLCLTRQPNTAREGDIKGAKSSD
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgagtttccgtcgcgagtccgtggactcctcggccgcggccttccaggtcagacacaag
gctgcccctttcgccagcaagcaccccaaagggttcggcgagatggtgctggttgacggc
gttagtatcgagaagacgtatctgctacctgtgccgaaccttcgcgagtggcttcctgag
catgacaaccaagtctgcaaccgccgcaaactcgacacgcaagctgatgactcggtcgaa
cgtaagagcacttacaacaagatcatgggcgagaccgacgtgatcctgggcgatatccgc
cgcaatgactcgcaggaggccgtttcgcgcgcttatgtgcgtgctggtccgcgcgggaac
acgtatttcgaccccgccaaggtcaaggccgctgctgtgacctgcggtggtttgtgcccg
ggcctgaacaatgttgtgcgcgatgtgaccctcgccttgtggaacctgtacggtgtccgc
gacatctacggtatccgcatgggcttcgccggcttctacaactggacctcaatggaccag
aaggaggcccccattatgctgacccctaagagcgtagctagcatccaccaccacggaggc
acgatcctcggctctaaccgtggcggcttcgaccaggacaagatcatcgacttcatgact
acgcatggcgtctcgcagctctacgtgattggcggtgatggtactcaccgtgctgccaac
aagatatcggaggaatgccgtcgccgcaagctggcaatcgctgttgccggtgtgcctaag
accatcgataacgatgttgatcttctggaccgcagcttcggttttaacactgccgtcgag
gaagcccagcgtgccattcgctcggccagcacggaggctcgttgcgtgcccaacggtatt
ggggttgtcaagctcatgggccgtagcgccggtttcattgccgcacacgcctcgctctcc
agtggtgacgttaacctgtgcctgatccccgagattccgatcgagctggaaggcccccgc
agctgcctggaccaccttgagcacgttgtggaggaacaaggtcatggtgtggtcgtcgtc
gctgagggcgctggtgaagagctgctaggcacgtcggtggaggcagatgccggcggcaac
aagaagctcccgcctattggcgctttcatgaaggaccgcatccaggaacacttcaccaag
aagggcaaggagtgcaccgtcaagtacattgacccctcgtacatgattcgctccgtgcca
gccaacgccgccgacagtctgtactgcatgctgctgggccagaacgccgtacacggcgct
atggccgggtacaccggtttcacggtcggccttagcgccaatcgtgtcgtgtacttcccc
attgaggccatcacacgcaactcaccgcgctgcatggaccccttcggtcgcacgtgggag
cgtgtgctgtgcctgacgcgccagcccaacacggctcgcgagggagacatcaagggcgcc
aagtcttctgactaa

DBGET integrated database retrieval system