KEGG   Phytophthora infestans: PITG_03598Help
Entry
PITG_03598        CDS       T01333                                 

Definition
6-phosphofructokinase, putative
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pif  Phytophthora infestans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:pif01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pif01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pif00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pif00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pif00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pif00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 504 aa AA seqDB search
MSFRRESVDSSAAAFQVRHKAAPFASKHPKGFGEMVLVDGVSIEKTYLLPVPNLREWLPE
HDNQVCNRRKLDTQADDSVERKSTYNKIMGETDVILGDIRRNDSQEAVSRAYVRAGPRGN
TYFDPAKVKAAAVTCGGLCPGLNNVVRDVTLALWNLYGVRDIYGIRMGFAGFYNWTSMDQ
KEAPIMLTPKSVASIHHHGGTILGSNRGGFDQDKIIDFMTTHGVSQLYVIGGDGTHRAAN
KISEECRRRKLAIAVAGVPKTIDNDVDLLDRSFGFNTAVEEAQRAIRSASTEARCVPNGI
GVVKLMGRSAGFIAAHASLSSGDVNLCLIPEIPIELEGPRSCLDHLEHVVEEQGHGVVVV
AEGAGEELLGTSVEADAGGNKKLPPIGAFMKDRIQEHFTKKGKECTVKYIDPSYMIRSVP
ANAADSLYCMLLGQNAVHGAMAGYTGFTVGLSANRVVYFPIEAITRNSPRCMDPFGRTWE
RVLCLTRQPNTAREGDIKGAKSSD
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgagtttccgtcgcgagtccgtggactcctcggccgcggccttccaggtcagacacaag
gctgcccctttcgccagcaagcaccccaaagggttcggcgagatggtgctggttgacggc
gttagtatcgagaagacgtatctgctacctgtgccgaaccttcgcgagtggcttcctgag
catgacaaccaagtctgcaaccgccgcaaactcgacacgcaagctgatgactcggtcgaa
cgtaagagcacttacaacaagatcatgggcgagaccgacgtgatcctgggcgatatccgc
cgcaatgactcgcaggaggccgtttcgcgcgcttatgtgcgtgctggtccgcgcgggaac
acgtatttcgaccccgccaaggtcaaggccgctgctgtgacctgcggtggtttgtgcccg
ggcctgaacaatgttgtgcgcgatgtgaccctcgccttgtggaacctgtacggtgtccgc
gacatctacggtatccgcatgggcttcgccggcttctacaactggacctcaatggaccag
aaggaggcccccattatgctgacccctaagagcgtagctagcatccaccaccacggaggc
acgatcctcggctctaaccgtggcggcttcgaccaggacaagatcatcgacttcatgact
acgcatggcgtctcgcagctctacgtgattggcggtgatggtactcaccgtgctgccaac
aagatatcggaggaatgccgtcgccgcaagctggcaatcgctgttgccggtgtgcctaag
accatcgataacgatgttgatcttctggaccgcagcttcggttttaacactgccgtcgag
gaagcccagcgtgccattcgctcggccagcacggaggctcgttgcgtgcccaacggtatt
ggggttgtcaagctcatgggccgtagcgccggtttcattgccgcacacgcctcgctctcc
agtggtgacgttaacctgtgcctgatccccgagattccgatcgagctggaaggcccccgc
agctgcctggaccaccttgagcacgttgtggaggaacaaggtcatggtgtggtcgtcgtc
gctgagggcgctggtgaagagctgctaggcacgtcggtggaggcagatgccggcggcaac
aagaagctcccgcctattggcgctttcatgaaggaccgcatccaggaacacttcaccaag
aagggcaaggagtgcaccgtcaagtacattgacccctcgtacatgattcgctccgtgcca
gccaacgccgccgacagtctgtactgcatgctgctgggccagaacgccgtacacggcgct
atggccgggtacaccggtttcacggtcggccttagcgccaatcgtgtcgtgtacttcccc
attgaggccatcacacgcaactcaccgcgctgcatggaccccttcggtcgcacgtgggag
cgtgtgctgtgcctgacgcgccagcccaacacggctcgcgagggagacatcaagggcgcc
aagtcttctgactaa

DBGET integrated database retrieval system