KEGG   Phytophthora infestans: PITG_03694Help
Entry
PITG_03694        CDS       T01333                                 

Definition
disulfide-isomerase, putative
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
pif  Phytophthora infestans
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pif00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PITG_03694
Enzymes [BR:pif01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PITG_03694
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 444 aa AA seqDB search
MRGVFVFAAASLLASVRGMYSSEDSVKVLDPESFREQVQQDSGVWLVEFYAPWCGHCKEL
APEYKKAAKALEGVVNVAAIDCQDHEEFVNEFAVRGFPTIKIFGENKAKPLSFDGERTAK
GLVDAALTASRRMVKARMSDGTEKKKRKPKPQPEKKSPSGKSSVITLTDDTFDEMVLNSG
DVWLVEFYAPWCGHCKALAPEWEQAASDLKGSVKVAALEATANELKASEYGIQGFPTIKV
FGPNAMGPQDAEDYQGERTASAITEFGLAALDTLGGGLRIKELVSADAVTDFCEGKSSCV
ISVLPHITEGGKRAREGYISTLEEAAKLVRGKPFKFGWMQGGDQLDFENRFELTFGYPSL
VAINLDRKRYVVQRGAFTAEAIAEFLQGVIQGRESTVGFDELPEIKTIKPWDGKDVQLDE
IEEDDEDDDIMNEILGNAAEKDEL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcggggagtgttcgtgttcgcggcggcaagcctgctggcgagcgtccggggtatgtac
tcgagtgaggacagcgtaaaggtactggacccggagagcttccgtgagcaagtgcaacag
gactctggagtgtggctcgtagagttctatgcgccatggtgcggccactgcaaggaactg
gcgcctgagtacaagaaggccgccaaggcgctggaaggcgttgtaaacgtggctgctatc
gattgccaagatcacgaggagtttgtgaacgagttcgcggtgcgcggcttcccgaccatt
aagatcttcggtgaaaataaggcgaaacccttgtcttttgacggcgagcgcacagccaag
ggcctcgtggacgccgcactcacggcctcgcgtcgaatggtcaaggcacgtatgtcggac
ggcacggagaagaaaaagcggaagcccaagcctcagcccgagaagaaatcgcccagtggt
aagagcagtgtcatcactctcactgacgatacgttcgatgagatggtgcttaacagtgga
gacgtgtggctcgtggagttctatgccccatggtgtggccactgcaaggctctagcccca
gagtgggagcaggccgcgtccgacctgaaggggtcagttaaggtcgctgcacttgaggcg
acggccaacgagctgaaggcgtcggagtacggaatccagggtttcccgacgattaaggtg
tttggaccgaatgctatgggtccccaggatgctgaggactaccagggtgagcgcacagct
tcagctatcaccgagttcggtctcgcggcgctggataccttgggtggcggattgcgcatc
aaggaacttgtgtcggctgacgctgtcacggacttttgtgaaggcaaatccagctgcgtt
attagtgtattgcctcacattacagaaggtggcaagagggcgcgtgagggctacataagc
acactcgaggaggctgcgaagctggtgcgtggcaagccatttaagttcggatggatgcaa
ggaggcgaccagcttgactttgagaatcgcttcgagctgacgttcgggtacccgtcgcta
gtggctatcaacttggaccgcaagcgctacgtggtgcagcgtggtgccttcacggcggaa
gcgattgctgagttcttgcagggcgtcattcagggtcgtgagtcgacggttggcttcgac
gagctgccggagattaagacgattaagccgtgggatggcaaggacgtgcagctggatgaa
attgaagaggacgatgaggacgacgacatcatgaacgaaatcctgggcaacgccgctgag
aaggatgaactttag

DBGET integrated database retrieval system