KEGG   Phytophthora infestans: PITG_03799Help
Entry
PITG_03799        CDS       T01333                                 

Definition
eukaryotic initiation factor 4E, putative
Orthology
K03259  
translation initiation factor 4E
Organism
pif  Phytophthora infestans
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:pif03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 273 aa AA seqDB search
MGEDKNNGEGEGKVAEKGTTETPIQNMYTFWYIKRSTGNKAVSESYEKSIKGLGDFKTVQ
DFWKIYNHLVRPNDLPNTMDYHLFKTGIKPMWEDSANRRGGKWMVRLRKGIASRYWEDLV
LAIIGEQFDVGNEICGAVISIRYNEDIISLWNRNADNNEACYRIRDTMRKVLNLPQFVAL
EYKRHDTSLNDNSSFRNTTLWRSEKNDGTSREGSSGGDRTSSGSRYSRGDKSSGHQRSSW
SRDNKRSFHKSDSNDNSHHRNSRTNDDKGEVDH
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgggggaggacaagaacaacggcgagggcgagggcaaggtcgcggagaagggaacgacg
gagacacctatccaaaatatgtacaccttctggtacatcaagcgcagcaccggcaacaag
gccgtcagtgagagctatgagaaaagcatcaaggggctcggtgacttcaagacggtccag
gacttttggaaaatatacaaccacttggtgcggccaaatgacctgccgaacaccatggac
taccacctcttcaagacgggcatcaagcctatgtgggaagactcggccaaccgaagagga
ggcaagtggatggtacgccttcgcaagggcattgcctcgcgttactgggaagatctggtg
ctagcgatcattggtgagcagttcgacgtgggtaacgagatctgtggcgctgtcatttcg
atccggtacaacgaggacatcatctcgctctggaaccgcaatgctgacaacaatgaagcg
tgctaccgtattcgtgatacgatgcggaaagtgctcaacctaccgcagtttgtggcattg
gagtacaagcgccacgacacgtcgctgaacgacaactctagtttccgcaacacgactctg
tggcgctcggaaaagaatgatggcactagccgtgagggctcttctggcggcgatcgtacg
tcctcgggctcgcgttactcccgtggagacaagtcttcaggccaccagcgatcttcttgg
agccgtgacaacaagcgttccttccacaagtccgacagcaatgacaacagccatcaccgt
aacagcaggaccaacgacgataagggcgaggtagatcattag

DBGET integrated database retrieval system