KEGG   Phytophthora infestans: PITG_03919Help
Entry
PITG_03919        CDS       T01333                                 

Definition
ribokinase, putative
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pif  Phytophthora infestans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PITG_03919
Enzymes [BR:pif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PITG_03919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 324 aa AA seqDB search
MTQTRKHVLVIGSVNADIVVEISRLPVRGETLSASKADTGKFFPGGKGSNQAAAAGKIIG
SNHPTLCAKFAGQFGNDTHGEALQTALQGSDVDTALAGHPACPSGQAFVFVYPDGDNSIV
IVGGANRAWPEELPAPLTDAIKSAAIILLQCEIPERINALVAKTAAETNVPVMWDTGGDD
TLIPADLLPLLTYVCPNETELARLTKREVNNTDDAIAAARYLQEQGAKNVLVSLGSDGSV
FIPVDSSEVVVHQKCFKVEKVVDTTGAGDCYRGAFAVAFAEGREVQDCMARAAAASALCV
QRAGALPSLPTGDEVVAFLNENGL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagacacgcaagcacgttctggttatcggctcggtgaatgccgacatcgtcgtg
gagatcagtcgcctacccgtgcgcggtgaaacattatccgcatccaaggcggataccggc
aagttctttccgggtggcaagggcagcaaccaggctgctgcagcaggcaagatcatcggc
tccaatcacccgacgctgtgcgcaaagttcgctggccaatttggcaacgacacgcacgga
gaggcactccagacagcactgcaaggctctgatgtggacacagcgctggctgggcaccca
gcctgtccgtcaggtcaggcatttgtgttcgtctacccggacggcgacaactcaatcgtt
atcgtgggtggtgccaaccgggcgtggcctgaagagctgccagccccattaacggacgcc
atcaagtcggcggctatcattttgctgcagtgcgaaattcctgagcgcatcaacgcgttg
gtggccaaaactgctgcggagaccaacgtacctgtcatgtgggacactggaggtgacgat
actctgatcccggctgacttgctgccattgttgacgtacgtttgccccaacgagacggag
ctggcacgtttgaccaaacgcgaggtgaacaacaccgacgatgccatagccgccgcgcgg
tatctgcaggagcagggtgctaagaacgtgctggtctccttgggctcagacggatctgtg
tttattcctgttgatagctcggaagtagtggtgcaccagaagtgcttcaaggtggagaag
gtggttgacacgacgggtgcaggagactgctaccgtggagcgtttgccgttgcttttgct
gaaggccgagaggtgcaggattgtatggctcgcgctgctgctgccagcgctctttgcgtg
caacgtgctggcgcactccctagtctgccgactggtgacgaggtcgtggcttttctcaat
gagaacggtttgtag

DBGET integrated database retrieval system