KEGG   Phytophthora infestans: PITG_03999Help
Entry
PITG_03999        CDS       T01333                                 

Definition
eukaryotic initiation factor 4E, putative
Orthology
K03259  
translation initiation factor 4E
Organism
pif  Phytophthora infestans
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:pif00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PITG_03999
Translation factors [BR:pif03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    PITG_03999
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 234 aa AA seqDB search
MSEQKNVKEPQQPVEEEKNDTTVAVPATVNEVATKHPLQNRWVLWYDNPKKRHSTESWEE
NLKNVYTFNTVEDFWCLYNNILAPTKLSIGSNYHLFKEGIRPMWEDPINAKGGKWIFTNP
RSRKARLDECWLYVMLSLIGETLQDEDDICGAVVSVRKAQDRIAIWSATANAEDRQKAIG
RGFRQALVDLGKNETLKYQSHADAAASGSSFQNEVYFHIRVVEICNICNSYTVV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcagaagaacgtgaaggagcctcagcagccagtggaggaggagaagaacgac
acgacggtcgctgtcccggccactgtgaacgaagtagccacgaagcatccactgcagaat
cgatgggtgttgtggtacgacaacccgaagaagcgtcactcaaccgagtcctgggaggaa
aacctgaagaacgtctacacgtttaacacggtggaggacttttggtgcctgtacaacaac
atcttggcacccacgaagctctcgattggcagcaactaccacttgtttaaggagggcatt
cgacccatgtgggaggacccgatcaacgccaaggggggcaagtggattttcactaacccc
cgctcccgaaaagcacgactagatgagtgctggctctacgtgatgctctcgctgattggc
gagacgctgcaggatgaggacgacatctgcggcgctgtagttagtgtacgcaaggcgcag
gaccgcatcgccatctggagtgcaacagccaatgccgaggaccgccagaaggccattggc
cggggctttcgccaagctcttgttgaccttggcaagaacgagacgctcaagtatcagtcg
catgctgacgctgcggccagtggatccagtttccagaacgaagtgtactttcacattcgc
gtagtagagatctgcaatatatgcaattcatacacagttgtttga

DBGET integrated database retrieval system