KEGG   Phytophthora infestans: PITG_04057Help
Entry
PITG_04057        CDS       T01333                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
pif  Phytophthora infestans
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PITG_04057
  Lipid metabolism
   00062 Fatty acid elongation
    PITG_04057
Enzymes [BR:pif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     PITG_04057
Lipid biosynthesis proteins [BR:pif01004]
 Fatty acid synthase
  Component type
   PITG_04057
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 344 aa AA seqDB search
MANCTSDLHLPAFFFHGLTGDPTNAVNYEQVFAANDRALVALSFAPGAESVAALPTQIPK
AIAQIREVVASDKRFQNGYVFIGHSLGGIMARSVIEEMDDHQVHTLISLAAPHSGLFYGP
QPEDTIPMQVLCTMANYELQMFPTDIFDFATYQNASNPAGLRGQAQRAFAELSVNRPELH
EQFAFVNLGRFPADEILLESNPFLPAINNVNKVDSDDAQALKEQKRRKQNFLRLQAAHFY
GSPDDKAAAPWQTSFFGRYSNVDSLEEIETKFENLTIVEGRDTEEFKSDTFGLKTLDERG
GLFFHEVADVPHTCWIADWPLLDDPTKTCTFQDVFDKFIFPALP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggccaactgcacgtcagatctccacttgcctgccttcttctttcacggactcacaggc
gatccgactaatgcagtcaactacgagcaagtgttcgccgccaacgaccgagcgcttgtg
gcgctgagttttgcgccaggtgcagagtcggtggcggcactgcctactcaaatccctaag
gctatcgcgcagatccgtgaagtagttgctagcgacaaaagattccaaaacggttatgtc
ttcattggtcattcgttagggggcataatggctcgatctgtcatcgaggagatggatgac
caccaagtgcacacgctcatcagcttggccgcacctcatagcggtctcttctacggacca
caacccgaggacactattccgatgcaagtgctgtgcacgatggccaactacgagttgcag
atgttcccgactgacatctttgactttgcaacgtatcaaaacgcaagtaaccccgctggg
cttcgtggtcaggcgcaacgtgcgttcgcggagctcagcgtcaacagaccggagttgcat
gagcagttcgcgttcgtcaaccttgggaggttcccagcggacgagatcttgctggagtcc
aacccattcctaccggcgattaacaacgtcaacaaggtcgattctgatgatgcccaagct
ctcaaagagcagaagcgacgcaagcagaactttctcagactccaagctgctcatttctac
ggatcaccagacgacaaagccgctgctccatggcagacatcgttctttgggcgatacagc
aacgtcgattctttggaagaaatcgagaccaagtttgagaacctcacgattgtcgaaggt
cgcgacacggaagagttcaagagcgatacgtttgggttgaagacgctggatgagcgtggc
gggctgttcttccacgaggtcgctgacgtgccgcatacttgttggattgcagattggcca
ctgctagatgacccaactaagacgtgcacctttcaagacgtcttcgacaagttcatcttt
ccagctttgccgtag

DBGET integrated database retrieval system