KEGG   Phytophthora infestans: PITG_04499Help
Entry
PITG_04499        CDS       T01333                                 

Definition
histone deacetylase, putative
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PITG_04499
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 447 aa AA seqDB search
MSSTNGSSVANTSGGTVASKRRVAYFYDSEIGNYHYGQNHPMKPHRVRMAHNLITNYGLT
KHMEVFRPRLVDWMELTRFHSDDYIHFLRLVTPDNMHEYLRQLQRFNVGEDCPVFDGLFE
FCQLYASASIGGAAKLNAGSADIVINYSGGLHHGKRSEASGFCYVNDCVLGILELLKAHQ
RVLYIDIDIHHGDGVEEAFYTTNRVMTCSFHKYGEFFPGTGDIKDIGYGDGKHYSVNFPC
RDGMDDESFTGIFRSVIAKVMEHFAPGAVLLQCGTDSLSGDRLGSFNLSAKGHADCVAYV
KSFNIPTLVVGGGGYTLRNVARAWCYEASLLVDVDIPDAMPYNDYFEYYGPEYRLHLPVS
NMENLNTPAYLDEIKRQIHENLRQIEPVPSVPFTVAPPSARIQEEKEAAARDREDDDQHM
MDVSGERQDQQELKQSDAPRHPVEFYD
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtaccaacggcagttccgtggcgaacaccagcggcggcaccgtagcttccaag
cgtcgcgtggcatacttctacgactcggagattggcaattaccactacggacagaaccac
cccatgaagccacatcgcgtgcgaatggcacacaacctcatcaccaactatggactcacc
aagcacatggaagtcttccgtcctcggctggtggactggatggaactcacccgcttccac
tcggacgattatatccacttcttgcggctcgtgacacccgacaacatgcacgagtatctg
cgccaattgcaacgcttcaacgtgggtgaggattgcccagtctttgatggtctcttcgag
ttctgccaactctacgcgtcggcatcgatcggcggcgctgctaaattgaacgcgggatcg
gccgacatcgtcatcaattactccggtggtctacatcacggcaagcgctcagaagcgtcc
ggtttctgctatgtgaacgactgcgtgctcggtattctggagctgctaaaagcccaccaa
cgcgtcctgtacatcgatatcgacatccaccacggtgacggagtggaggaggcattttac
acgacgaaccgggtgatgacttgctcattccacaaatacggcgagttcttccccggcacg
ggcgatattaaagatatcggctatggagacggcaagcattactctgtcaactttccgtgc
cgcgacggcatggacgacgagagctttaccggtatctttcgcagcgtcattgccaaggta
atggagcattttgcgccgggtgctgtgctgctgcagtgcggcacagactcgctttctggt
gacagacttggcagcttcaacctgtcagccaagggccacgccgactgcgtggcgtacgtc
aagagctttaacatccccactcttgttgtcggcggcggtggttatacattgcggaatgtg
gcacgtgcctggtgctacgaggcatcgctgctggtggacgttgatatcccagatgcgatg
ccctacaacgactactttgagtactatggacctgagtaccgcctacacttgcccgtgagc
aacatggaaaacctcaacacacccgcttacctggacgaaattaagcgtcagatccatgag
aacctccgccaaatcgaacctgttcccagtgtgcctttcacagtcgcaccaccgtcagct
cgaattcaagaggagaaggaagctgccgcgcgcgaccgtgaggatgacgatcagcacatg
atggatgtgtcgggcgaacgtcaagaccaacaagaactcaagcagagcgacgctccccgt
catcctgttgaattttacgactaa

DBGET integrated database retrieval system