KEGG   Phytophthora infestans: PITG_04681Help
Entry
PITG_04681        CDS       T01333                                 

Definition
serine/threonine-protein phosphatase PP1-gamma catalytic subunit
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
pif  Phytophthora infestans
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:pif00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    PITG_04681
Enzymes [BR:pif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     PITG_04681
Protein phosphatases and associated proteins [BR:pif01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     PITG_04681
Transcription machinery [BR:pif03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     PITG_04681
Spliceosome [BR:pif03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    PITG_04681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 323 aa AA seqDB search
MASSGLEPIDVDSIIEKLLSVRGARPGKQVNLTETEIRGLCLHAREVFLAQPILVELEAP
IKICGDIHGQYYDLLRLFEYGGFPPDANYLFLGDYVDRGKQSLETICLLLAYKIKYPENF
FILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCMHGGLSP
ELSQMEQIKRFVRPTDVPDTGLLCDLLWSDPDKDIMGWGENDRGVSFTFGPDIVSQFLKR
HDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKP
AEKKQRYAYNGLGTQRPATPPRK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtccggactagagcccatcgacgtggacagcatcattgagaagctgctaagt
gtgcgcggcgcgcgccccggcaagcaggtgaatctcacggagaccgagatccgcgggctg
tgccttcacgcacgcgaggtttttctggcgcagcccattctggtggagctggaggcgccc
atcaaaatttgcggtgacatccacggccagtactacgatctgctgcgtttgttcgagtac
ggcgggttccctccggacgccaactacctgttcctcggagactacgtggaccgtggcaaa
cagagtctggagaccatctgcctgctgctggcttacaagatcaagtacccagagaacttc
tttatcctgcgtggcaaccacgagtgcgcgtcgattaaccgaatttacggcttctatgac
gagtgcaagcgccgctacaacatcaagctctggaagaccttcaccgactgctttaactgc
ctgccagtggctgctatcgtggatgagaagatcttctgcatgcacggcggtctgtccccc
gagctgagtcagatggaacagatcaagcgcttcgtgcgccccacagacgtccccgacacg
ggtctgctctgcgatctgctgtggtccgaccccgacaaggacattatgggctggggagag
aacgaccgcggcgtgtcgttcacgttcggcccggacattgtgagtcagttcctcaagcgt
cacgacctcgatttgatctgcagagctcaccaggtggtggaggatggctatgaattcttc
gccaagcgccagctggtcacgttgttctccgcaccgaactactgcggcgagttcgacaac
gccggtgcgatgatgtcggtcgacgagacgctcatgtgctcgttccagatccttaagcca
gccgagaagaagcagcgctacgcttacaacggccttggcacgcaacgtcccgcgacgccg
cccaggaagtag

DBGET integrated database retrieval system