KEGG   Phytophthora infestans: PITG_04851Help
Entry
PITG_04851        CDS       T01333                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pif  Phytophthora infestans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pif01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pif00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 355 aa AA seqDB search
MQRRVPTSLLRCMQQRGISSSSSRQWDQVRPHFHAGAHGNPKLNLPQTVSIIGAPMTYGQ
PLLGTDGGPDLLREAGLHKTLVDLGWSVEENGNLNFVAPSSNDPTLDSRYGKAKQCFPVG
NGTKQLYETFKQKAGEGKFCLVLGGDHTIGAGSLAGLLSVHPDAGVIWVDAHADINTPAD
SESGNMHGMPIAFLMDGMVDSSKIPGFEWLSNGPKMKPEQLVYVGLRDVDSFERRVIHEK
GIKAFSMQEVDRYGIGKTMEMALDHLCGKKQRPLHMSYDIDAVDPLVAPSTGTRVRGGLT
WREAHYVAEAVAETNLMVGLDMVEVNPTLAPGDGAQITVDMALMLISSALGNRIL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccgcgttcccacgtcgctcctgcgctgcatgcagcagcgcggcatctcgagc
tcgtccagccgccaatgggaccaagtgcgcccgcatttccacgccggggcgcacggcaac
ccgaagctaaacctgccgcagactgtgtcaattatcggcgcccccatgacgtacggccag
ccactgctgggcacggacggcggtccagatctattgcgcgaggctggattacacaagact
ttggtagacttgggctggtctgtagaggagaacggtaacctcaacttcgtggcgccatcc
tctaacgatccgacgctcgactcacgctacggcaaagccaagcagtgctttcctgttggc
aacggcacgaagcagttgtacgagactttcaagcaaaaagcaggggagggcaagttctgt
ttggtgttgggtggtgaccacactattggagctggatcccttgcaggattgctgtctgtg
caccctgacgcgggcgttatctgggtagatgcccacgcggacatcaacacgccggcggac
tcggagtctggcaacatgcacggtatgccaatcgccttcctcatggacggtatggtggac
agctccaagattccaggcttcgagtggctcagtaatggccccaagatgaagccggagcag
ctcgtgtacgtcggtctgcgcgacgtcgactcgttcgaacgtcgcgtcatccatgagaag
ggaattaaggcgttctctatgcaagaagtggaccgctacggtattggcaagacgatggag
atggcgctggaccatctttgtggcaagaagcagcggcctttgcacatgagctacgatatc
gacgcagtggacccactggtggctccctcgacaggcacacgtgtacgtggtggccttacg
tggcgtgaggctcattacgtcgctgaagctgtggcggaaaccaacttgatggtgggtctg
gacatggtcgaagtgaacccgacgctggcacctggcgatggagctcagattacggtcgac
atggcgctcatgctcatctcgtcggcgctcggaaaccgcatcttgtaa

DBGET integrated database retrieval system