KEGG   Phytophthora infestans: PITG_05318Help
Entry
PITG_05318        CDS       T01333                                 

Definition
(RefSeq) N-(5'-phosphoribosyl)anthranilate isomerase indole-3-glycerol-phosphate synthase, putative
  KO
K13501  anthranilate synthase / indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.3.27 4.1.1.48 5.3.1.24]
Organism
pif  Phytophthora infestans
Pathway
pif00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pif01100  Metabolic pathways
pif01110  Biosynthesis of secondary metabolites
pif01130  Biosynthesis of antibiotics
pif01230  Biosynthesis of amino acids
Module
pif_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PITG_05318
Enzymes [BR:pif01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PITG_05318
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     PITG_05318
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     PITG_05318
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IGPS PRAI FMN_dh TMP-TENI
Motif
Other DBs
NCBI-GeneID: 9462947
NCBI-ProteinID: XP_002998985
UniProt: D0N427
AA seq 561 aa AA seqDB search
MGNILEEIAAQRRLDVAAAKQVISADDLAKKIEHAEVVFGSTLPVLDRLNAPTREGWSDV
ALAAEFKRASPSKGDIATELNLREQVQAYANAGASMISVLTEPKWFKGSLDDMRAAREVV
EGMSQRPAILRKDFIIDVYQLLEARAYGADCVLLIVALLSQEQLIELIDATHNLGMCALV
EVNSIQELDIALAARARLIGVNNRDLRTFKVDMNTTARVADAIRERGLSLGRDGVTLFAL
SGIRSHADVVKYEKCGARGILVGEYLMKSGDIAATVKDLLQNVTRHTESGEFALAPPLAK
VCGVTTVEYALAALRNGANMIGIIMAEHSPRYVQVEEAKAIAQAVWEYGERTGPILSDIV
ETHLDGKNDWFHRNVLALREACSRAPLVVGVFVNKTAAEMNATAKEIGLDLVQLHGDEGF
QICRDIKYPTIRALHLPDTTLCDGVDAEAVLQQVQEGLANYILLDTTVKGQQGGTGVTFD
WKIAAIFAQARLPCLMAGGLTPENVVKALSVGHPVGVDVSSGVEVKGSPGVKDMDKVTAF
LKAVKDYLSIATLKIEEETET
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacatcctggaggagatcgcagcgcagcgccgtctggacgtggcggccgccaag
caggtcatatccgccgatgatctggccaagaagatcgagcacgcggaggtcgttttcggc
tcgaccctgcccgtgcttgaccgccttaacgcacccacgagagaggggtggtccgacgtg
gctctggctgccgagtttaagcgtgcgagccccagcaaaggtgacatcgccacggagctc
aatctgcgtgagcaagtgcaggcctacgccaacgcaggtgccagtatgatctccgtactg
acagagcccaagtggtttaagggatcgctagacgacatgagggcagcccgggaggtggtc
gagggcatgagtcagcgtcctgccatcctgcgcaaggatttcatcatcgacgtgtaccag
ttgctggaggcccgcgcttacggagcggattgcgtgttgctcatcgttgcgctgctgtcc
caggagcagcttatcgagctcattgacgccacccacaatctcggtatgtgcgctctggtc
gaggtgaacagcatccaggagctggacatcgctctggctgcgagggctcgactcattggc
gtcaacaaccgcgatctccgcacgtttaaggtagacatgaacacgacggctcgcgttgca
gacgctattcgtgagcgtgggctttcgctgggacgtgacggcgttacgctctttgctctc
agtggcattcgctcgcacgcagacgtggtcaagtacgagaagtgcggcgcccggggcatc
ttggtgggcgagtacttgatgaagagtggtgatattgccgcgacggtgaaggatctcttg
cagaatgtgacgcgtcacaccgagtcgggcgaattcgctttggctcctccgcttgccaaa
gtgtgcggcgtcacgacagtggagtacgcgctggcggccttgcgtaatggtgccaatatg
attggtatcatcatggcggaacactcaccccgctatgtccaagtggaggaagccaaggcc
attgcccaggctgtgtgggagtatggggagcgcacgggccctattctctcagacattgtg
gagactcacttggacggcaagaacgactggtttcatagaaatgtccttgcgttgcgtgaa
gcttgctcgcgtgcacctctcgtggtcggagtgtttgtcaacaagacagctgccgagatg
aacgcgactgcaaaggaaatcggactggacttggtacagctacacggcgacgaggggttt
cagatctgcagggacattaagtaccccaccattcgcgcgttgcatctgcccgacaccacg
ctctgcgacggcgtggacgcagaagccgttctacagcaggttcaggaaggccttgccaac
tacattctgcttgatacgaccgtgaagggtcagcagggcggcactggcgtcacattcgac
tggaagattgcagccatctttgcgcaggcacgacttccctgcctcatggctggtggcctt
acccctgagaacgtggtgaaggctctatcggtcggtcaccccgttggggtggatgttagc
agtggagtggaagtgaaaggttcacctggtgtgaaggatatggacaaggtgactgcgttc
ctaaaggctgtgaaggattacctctcgattgctacgcttaagatcgaggaggagacggaa
acctag

DBGET integrated database retrieval system