KEGG   Phytophthora infestans: PITG_05318Help
Entry
PITG_05318        CDS       T01333                                 

Definition
N-(5'-phosphoribosyl)anthranilate isomerase indole-3-glycerol-phosphate synthase, putative
Orthology
K13501  
anthranilate synthase / indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.3.27 4.1.1.48 5.3.1.24]
Organism
pif  Phytophthora infestans
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pif01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pif00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 561 aa AA seqDB search
MGNILEEIAAQRRLDVAAAKQVISADDLAKKIEHAEVVFGSTLPVLDRLNAPTREGWSDV
ALAAEFKRASPSKGDIATELNLREQVQAYANAGASMISVLTEPKWFKGSLDDMRAAREVV
EGMSQRPAILRKDFIIDVYQLLEARAYGADCVLLIVALLSQEQLIELIDATHNLGMCALV
EVNSIQELDIALAARARLIGVNNRDLRTFKVDMNTTARVADAIRERGLSLGRDGVTLFAL
SGIRSHADVVKYEKCGARGILVGEYLMKSGDIAATVKDLLQNVTRHTESGEFALAPPLAK
VCGVTTVEYALAALRNGANMIGIIMAEHSPRYVQVEEAKAIAQAVWEYGERTGPILSDIV
ETHLDGKNDWFHRNVLALREACSRAPLVVGVFVNKTAAEMNATAKEIGLDLVQLHGDEGF
QICRDIKYPTIRALHLPDTTLCDGVDAEAVLQQVQEGLANYILLDTTVKGQQGGTGVTFD
WKIAAIFAQARLPCLMAGGLTPENVVKALSVGHPVGVDVSSGVEVKGSPGVKDMDKVTAF
LKAVKDYLSIATLKIEEETET
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacatcctggaggagatcgcagcgcagcgccgtctggacgtggcggccgccaag
caggtcatatccgccgatgatctggccaagaagatcgagcacgcggaggtcgttttcggc
tcgaccctgcccgtgcttgaccgccttaacgcacccacgagagaggggtggtccgacgtg
gctctggctgccgagtttaagcgtgcgagccccagcaaaggtgacatcgccacggagctc
aatctgcgtgagcaagtgcaggcctacgccaacgcaggtgccagtatgatctccgtactg
acagagcccaagtggtttaagggatcgctagacgacatgagggcagcccgggaggtggtc
gagggcatgagtcagcgtcctgccatcctgcgcaaggatttcatcatcgacgtgtaccag
ttgctggaggcccgcgcttacggagcggattgcgtgttgctcatcgttgcgctgctgtcc
caggagcagcttatcgagctcattgacgccacccacaatctcggtatgtgcgctctggtc
gaggtgaacagcatccaggagctggacatcgctctggctgcgagggctcgactcattggc
gtcaacaaccgcgatctccgcacgtttaaggtagacatgaacacgacggctcgcgttgca
gacgctattcgtgagcgtgggctttcgctgggacgtgacggcgttacgctctttgctctc
agtggcattcgctcgcacgcagacgtggtcaagtacgagaagtgcggcgcccggggcatc
ttggtgggcgagtacttgatgaagagtggtgatattgccgcgacggtgaaggatctcttg
cagaatgtgacgcgtcacaccgagtcgggcgaattcgctttggctcctccgcttgccaaa
gtgtgcggcgtcacgacagtggagtacgcgctggcggccttgcgtaatggtgccaatatg
attggtatcatcatggcggaacactcaccccgctatgtccaagtggaggaagccaaggcc
attgcccaggctgtgtgggagtatggggagcgcacgggccctattctctcagacattgtg
gagactcacttggacggcaagaacgactggtttcatagaaatgtccttgcgttgcgtgaa
gcttgctcgcgtgcacctctcgtggtcggagtgtttgtcaacaagacagctgccgagatg
aacgcgactgcaaaggaaatcggactggacttggtacagctacacggcgacgaggggttt
cagatctgcagggacattaagtaccccaccattcgcgcgttgcatctgcccgacaccacg
ctctgcgacggcgtggacgcagaagccgttctacagcaggttcaggaaggccttgccaac
tacattctgcttgatacgaccgtgaagggtcagcagggcggcactggcgtcacattcgac
tggaagattgcagccatctttgcgcaggcacgacttccctgcctcatggctggtggcctt
acccctgagaacgtggtgaaggctctatcggtcggtcaccccgttggggtggatgttagc
agtggagtggaagtgaaaggttcacctggtgtgaaggatatggacaaggtgactgcgttc
ctaaaggctgtgaaggattacctctcgattgctacgcttaagatcgaggaggagacggaa
acctag

DBGET integrated database retrieval system