KEGG   Phytophthora infestans: PITG_05517Help
Entry
PITG_05517        CDS       T01333                                 

Definition
regulatory-associated protein of mTOR
Orthology
K07204  
regulatory associated protein of mTOR
Organism
pif  Phytophthora infestans
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1339 aa AA seqDB search
MDIVPWRMRERMKTMDVALVLCLNIGTDPPDVEKSSPCARKECWVDPFSMPAKKAIETIG
NTLQSQYERWQPRARYKQSLDPTVEKIRELCVNRRRLAKHDRMLFHYNGHGVPRPTQNGE
VWVFNKSYTQYIPLLVYDLQSWVGTPSIYVFDCSAAGVLLSHFTSPPASQPQMHGRNGSP
SAKEAIVLAACSDDELLPMNPELCADVFTSCLTTPITVALRWFISQNELSMAHLDASFIE
RIPGKLTDRKTPLGELNWIFTAITDTIAWNMLPRELFQKLFRQDLLVASLFRNFLLAERI
MKSAGCSPCSLPALPPTNHHSLWRSWDLAAEVCLNQLYKLSNPYPNVDMSFQPSRFFAEQ
LTAFEVWLQFGSSEKPPPQQLPMVLQVLLSQVHRLRALVLLKKFLDLGPWAVNLALSVGI
FPYVLKLLQSPASELRQVLVFIWAKILALDSSCQVDLVKDDGHSYFISHLAAGLHNGGGS
QSAYSAASSMMPAEQKVMAAFIISVICNKYQPGQKSCLPQYLHKICINLLQDPDEEVRKW
ICLCLAKLWDNFDDAKRIVIEDKVPRILGGRLRDDRPEVRAAAAYALGTLVGFQCDPNTS
GKHVDMNRLEDFLRQRAHDDIVVALELLRGCRDGSPLVRRESVLALANVILHNYHQPRFE
SVAKHFKNQPVSASANSPADHRSSAVDMGFQSGNDARNSLESVNDAAFQGSADVFVDEEL
LDEIGEDAKHYAQIWHVLKEMQSRDPYPHVVDAVKAIVSFVNASILEAEQDQLRETSQTG
SVLASPPRSAVPEKLTATRTERSPAAASQFRREGSVPGLANNQVQRNDDRFGVPLENTSL
TSTIAEQGNLIRAPETQMQPAASTLKGLRSAASVGNFQQYQNKFQQGSGSIQSTGDIHVM
PPPTSAGSKMIAGQYLGQTSSPMGGYRVANNGLPSEGGMGGYPVHVPPPMERYGRHDDFP
STLVSTCYERHKAHFNDSILEPVQEDEDPLSEMGAERWERCRRYNRIRGAAMKLAPGFSS
PRSSTTQKFGLGMRDVSPHNPPPYSPIEYDAARRMSTLGDQEEVKDFTMNLRQRAVLNND
AEMTSLLLFHPYETMLLVADEKDQISLYNFEETETKMLTFGNKNPPGSRLTSLNWINETE
ESLLTCGSDDGVIKIYHGLHSPHQSIGSPKLLSAFVAVPDLVPGTRGSGLVMNWQQETGM
MYAGGNSSMLRGWELRQEKCTIALPTQTDSCITSMTSDKSLPGMLVAGFGDGTLRVFDAR
SRPDYAVKTIMKEHTSWVVQTHIYAGRNELLTGSVTGELKFWDMRYPKNSVKSLEAHRSP
MTALAVHDYAPIFARYVMI
NT seq 4020 nt NT seq  +upstreamnt  +downstreamnt
atggacattgtgccgtggcgtatgcgtgagcgtatgaagacaatggacgtggccctggtt
ctgtgtctcaacattggaacagaccctccggacgtggagaaatcgtctccttgtgctcgc
aaagagtgctgggtggacccgttctctatgccggccaagaaggctattgaaaccattggc
aacacactgcagtcccagtacgagcgctggcaaccacgtgctcgctacaaacagagctta
gatccgacggtcgaaaagattcgcgagctgtgtgtgaaccgacgaagactagccaagcac
gaccgcatgctattccactacaatggccacggtgtacctcgaccgacgcagaatggagag
gtatgggtgttcaataagagctatacgcaatatatcccgttgctagtgtacgacctgcag
tcgtgggtggggacgccgtcgatctacgtgtttgactgctcggcggcaggagtcctgctg
agccatttcacgtcgcctccagcaagtcaacctcaaatgcacggacgaaatggaagccca
tcagctaaggaagccatcgtgctggctgcatgttctgatgacgaactgttaccgatgaac
ccggagctgtgtgcagacgtgtttacttcttgcttgacgacgcctattaccgtcgcgctg
cgatggtttatctcgcagaacgaactctcgatggcgcatttggatgccagcttcattgag
cgtatccctggaaagctgaccgacagaaagacacccctgggagagctcaattggattttc
acagcaattaccgatacaattgcgtggaatatgctgcctcgtgaacttttccagaagcta
tttcgtcaggatttacttgtggcgtcgctcttccgtaacttcttgctagcagagcgtatt
atgaagtctgcaggttgctcaccatgctcgcttccggccttaccaccgacaaatcaccac
tctttgtggcgctcgtgggacttggctgctgaggtttgcttaaatcagctctacaaactg
tcaaatccatacccgaatgttgatatgagcttccagccgtcgcggttcttcgcggagcag
ctcacagcgttcgaggtatggctacagttcgggtcttcggagaagccaccgccgcaacag
ctgcctatggttctgcaagtgcttttaagtcaagttcatcgtcttcgcgcactggtgcta
ctgaagaaattcctcgacttgggaccgtgggctgtgaacttggctctttctgttggaata
ttcccgtatgtactcaagctgctccaatctccagcgagtgagcttcgacaagtgcttgtc
tttatctgggcaaaaatcctggcgttggactcaagttgccaagtggaccttgtgaaggat
gatggtcattcctacttcatctctcatctcgctgcagggcttcacaacggtggagggagc
cagagtgcttacagcgctgcgagcagtatgatgcctgcagagcagaaagtcatggcggcc
ttcattatctctgtgatctgcaacaagtaccaacctggccaaaagagctgcttgccacaa
tacttgcacaagatttgcatcaatctgcttcaagatcctgacgaagaagtgcgcaagtgg
atttgtctgtgtctggcgaagttgtgggataattttgacgacgcaaagcgtatagtgatc
gaagacaaggtgccacggatacttggcggcaggcttcgtgacgatcgccccgaagtgcgt
gctgctgccgcttacgcgcttggaactttagttggcttccaatgtgaccccaacacaagc
gggaagcatgttgatatgaaccgcttagaggattttcttcgacagcgagcgcatgacgac
attgtcgtagctttggagctgctgcgtggttgtcgggatggatctcctttggtacgtcgg
gagagtgtgttagctctggccaatgttatcctgcacaactaccaccaaccacgtttcgag
tccgtagccaagcactttaagaaccagccagtgagtgcttcagccaattctcctgctgac
cacagatcttctgcggttgatatgggctttcagagcggtaatgatgctcgaaattcgctt
gagagtgtcaacgacgcggcttttcaaggcagcgcagatgtgttcgtcgacgaggagctt
ctggatgaaatcggagaggatgctaaacactatgcgcaaatctggcatgtgctcaaggaa
atgcagtccagagacccatacccgcatgtggttgacgctgttaaagcgattgtcagcttc
gtgaacgccagtatcttggaagctgagcaggatcaactgcgagaaaccagtcagacggga
agcgtgttagcttcccctccgcgtagtgcagttcctgaaaagctcacggccacgcgtacg
gagagaagtcctgctgcggcgtctcaatttcgacgagaaggctctgtgcccgggttggcg
aacaaccaggttcaacgaaatgacgaccggtttggagtccccttagagaatacatctctc
acctcgacaattgccgagcaaggcaacttgattagagctccagagacgcaaatgcaacct
gctgcgtctacattaaagggattgcgatcagctgcgtcggtgggcaacttccagcagtat
caaaacaagtttcaacaaggatctggcagtattcagagcactggagatatccacgtgatg
ccacctcccacgagcgcagggagtaaaatgattgcaggacaatatcttggacaaacctct
tctcccatggggggatacagagtagcgaacaatggtctgccgagtgaaggaggcatggga
ggctatccagtgcacgttccccctccgatggaacgctatggccgccacgacgacttcccg
tcaacactagtgtccacatgctacgaacgacacaaagctcacttcaatgattcgattctg
gagcccgtacaggaggacgaggacccactaagtgagatgggcgctgagaggtgggaacgc
tgtcgccgctacaaccgcattcgaggtgcagctatgaaacttgcacctggtttctcttct
cctcgaagctcgacaacgcagaaatttggtttaggcatgcgggatgttagtccgcacaat
ccaccgccgtactcacctatcgagtatgatgctgcacgtcgtatgtcaactcttggtgac
caggaagaagtaaaggactttacgatgaacctccgtcagcgggctgtgctgaataacgac
gcagagatgacatcattgttgctgttccacccgtacgaaacgatgctacttgttgctgac
gagaaagaccaaatctcactttacaactttgaagaaacggagacgaagatgctgacgttt
ggaaacaagaatccgcccggctcgcgattgacatcattgaactggatcaatgaaactgag
gagagcctcttgacatgtggctcggatgatggcgttataaagatttaccatggtttgcac
agtcctcaccagtcgataggcagtccgaaacttctatccgctttcgttgcggtgcctgat
ctagtgccgggaactcgtggatctggtttggtgatgaattggcagcaagaaactggtatg
atgtatgctggtggcaactcaagcatgctccgaggctgggaattacgacaagagaaatgc
accatcgcacttcctactcagacggactcttgcatcacaagtatgacgagtgataagagt
ctccccgggatgctggtggctggttttggtgatggcactttacgagtctttgacgcacgt
agcagaccagactacgcagtcaaaacgatcatgaaggaacacacgtcgtgggtggtgcag
acccacatctacgccggtcgcaatgagcttctaactggatccgtgaccggtgagttaaag
ttctgggatatgcggtatccgaagaatagtgtcaagtctttggaagcgcatcgatcaccg
atgactgccctcgccgtgcatgactacgccccgatatttgcaaggtacgttatgatatga

DBGET integrated database retrieval system