KEGG   Phytophthora infestans: PITG_06016Help
Entry
PITG_06016        CDS       T01333                                 

Definition
glucokinase, putative
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pif  Phytophthora infestans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PITG_06016
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PITG_06016
   00052 Galactose metabolism
    PITG_06016
   00500 Starch and sucrose metabolism
    PITG_06016
   00520 Amino sugar and nucleotide sugar metabolism
    PITG_06016
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    PITG_06016
Enzymes [BR:pif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PITG_06016
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 353 aa AA seqDB search
MSDYSLIISGDCGGTNTRLSLWKIPTGATQLKGNIAPGDVIFAKKYLNEDHASFNEVCHL
FMNEAKLTDHVPEACVLACAGPILNNTVDFTNVEFGWKIDGASLEKELGIKQVQLINDFA
AMGYGLLTLRPHEYIVLNDAPKDETAPMATIGAGTGLGECFLTPGNDGQYSCFACEGGHT
DFAPADEIEIELYNEIKAKLGCSQRFSVERIVSGPGLATIYEFLAKKFPEKVDPKVHEEF
LKANTQQGKVIGENAKTNELCNQTLEIFVGAYGREAGNAMLKYLPRGGFYITGGLAPKNL
DYFTKKDIFLKSLFDKGRVSPALKACPIYLVLTEELGERGAHFYAYQLLHSSA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtctgactacagcctcatcatctccggcgactgcggtggcaccaacacgcgtctgtcg
ctgtggaagatccccaccggcgccacccagctcaagggcaacattgccccgggtgatgtt
attttcgccaagaaatacctcaacgaggaccacgcttcgttcaacgaagtgtgccacctc
ttcatgaacgaggccaagctcactgaccacgtgccggaggcttgtgtcctcgcttgtgcc
ggccctatcctcaacaacacggtggacttcaccaacgtcgagttcggatggaagatcgac
ggtgcaagtctcgagaaggagcttggcattaagcaagtccaactaatcaacgactttgcc
gccatgggctacggtctgttgacactgcgtccgcacgagtacattgtcctaaacgacgct
cctaaggacgagaccgcgcctatggctaccattggagctggtaccggtcttggagagtgc
ttcttgactcctggcaacgacggtcagtactcgtgcttcgcctgtgaaggtggccacact
gacttcgcccctgcggatgagatcgagatcgaactgtacaatgagatcaaagccaaactg
ggctgcagtcagcgtttctcggtggagcgtattgtgtctggccctggtctggcgacgatc
tacgagttcttggccaagaagttccctgagaaggtggacccgaaggtgcacgaggaattc
ctcaaggccaacacgcaacagggcaaggtgattggcgagaatgccaagacgaacgagctg
tgcaaccagactctggagatcttcgtgggtgcgtacggccgtgaggctggtaacgcgatg
ctgaagtatctgcctcgtggtggcttctacatcactggtggtctcgctcctaagaacctg
gactacttcactaagaaggacattttccttaagtctctgtttgacaagggtcgtgtgagc
cctgctctgaaggcttgccccatctacctggtgcttaccgaggagcttggtgagcgtggt
gcccacttctacgcgtaccagctcttgcactcgagcgcgtag

DBGET integrated database retrieval system