KEGG   Phytophthora infestans: PITG_06021Help
Entry
PITG_06021        CDS       T01333                                 

Definition
(RefSeq) glucokinase, putative
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pif  Phytophthora infestans
Pathway
pif00010  Glycolysis / Gluconeogenesis
pif00052  Galactose metabolism
pif00500  Starch and sucrose metabolism
pif00520  Amino sugar and nucleotide sugar metabolism
pif01100  Metabolic pathways
pif01110  Biosynthesis of secondary metabolites
pif01130  Biosynthesis of antibiotics
pif01200  Carbon metabolism
Module
pif_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pif_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PITG_06021
   00052 Galactose metabolism
    PITG_06021
   00500 Starch and sucrose metabolism
    PITG_06021
   00520 Amino sugar and nucleotide sugar metabolism
    PITG_06021
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PITG_06021
Enzymes [BR:pif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PITG_06021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-GeneID: 9472200
NCBI-ProteinID: XP_002998232
UniProt: D0N687
AA seq 346 aa AA seqDB search
MSGDCGGTNTRLALWNIPKSSVYTKGDIAPGEMLFSKKYLNEEHGSFNEVCHLFLNEAKL
VDEVPAACVLACAGPILSNTVDFTNVESGWKIDGTSLEKILGIRTVRLINDFAAMGYGLL
TLRPHEYIVLNDVPKDETAPMATIGAGTGLGECFLTPGNDGQYSCFACEGGHTDFAPADE
IEIELYNEIKAKLGCSQRFSVERIVSGPGLATIYEFLAKKFPEKVDPKVHEEFLQANTQQ
GKVIGENAKTNELCNQTLEIFVGAYGREAGNAMLKYLPRGGFYITGGLAPKNLDYFTKKD
IFLNSVFDKGRVSPALKACPIYLVLTEDLGERGAHFFAYQLLGQCE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcgactgcggtggcaccaatactcgcctggcgctgtggaacatccccaagagc
tcagtgtatacaaagggcgacatcgctccgggcgagatgttgttctccaagaaatatctg
aacgaagagcacggaagcttcaacgaggtatgtcacctctttttaaacgaagccaaactc
gtggacgaggtgcctgctgcgtgcgtattagcctgcgccggtcccatccttagcaacacg
gtggacttcaccaatgtggagtcaggctggaagatcgacggtactagtctcgaaaaaata
ctcggaattaggaccgtgcgtctgatcaacgactttgctgccatgggctacggtctgctg
accctgcgtcctcatgagtatatcgtccttaacgacgtccctaaagatgagacggctcct
atggctaccattggagctggtaccggtcttggcgaatgcttcttgactcctggtaacgac
ggtcagtactcgtgcttcgcctgtgaaggtggccacactgacttcgcccccgcggatgag
atcgagatcgaactgtacaatgagatcaaggccaaactgggttgcagtcagcgtttctcg
gtggagcgtattgtgtctggtcctggtctggcgacgatctacgagttcttggccaagaag
ttccctgagaaggtggacccgaaggtgcacgaggaattcctccaggccaacacgcaacag
ggcaaggtgattggcgagaacgccaagacgaacgagctgtgcaaccagactctggagatc
ttcgtgggtgcgtacggccgtgaggctggcaacgcgatgctgaagtatttgcctcgtggt
ggcttctacatcactggtggacttgctcctaagaacctggactacttcaccaagaaggac
atttttctcaactctgtgttcgacaagggccgtgtgagtcctgctcttaaggcatgccca
atctacctggtgcttaccgaggacctgggcgagcgtggtgctcacttcttcgcctatcag
ctactaggccagtgcgaataa

DBGET integrated database retrieval system