KEGG   Phytophthora infestans: PITG_06257Help
Entry
PITG_06257        CDS       T01333                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
pif  Phytophthora infestans
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:pif03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2100 aa AA seqDB search
MSESLSLADAPALRFRQLHQDLLAFAGQSMSDDDAPQYMAELVAAAPELLQPLALAPPSA
SERAALQANTVNVAGKHVDVSPLIQQEICKLSDEFRASEKTCFEFWLMASEQQQREWVER
ADQLPPGTIANSVQNAARYFLTSETEYKLHLLKELLRLRLETQLDKQRAQFIVSFTNKLL
TEELLTNLVTAFDTQLTQLVQVARMEQSVSYWHTLVADCLVFIVSSTLTLAKEVQKLAEL
LKTLCGRLKTVVAKVSPHIVNLSSFAQLFEGGSLAGTSPEGAVRQVSCMLQTITAVQVAL
FVVLLQKSRKMDRETGDMEMGISLCRREHASVVTELHRIFFVEEWEQRGLQSVAMLMWAG
FLAGNNNDNSSNSNVSFAEADDATSVVKKAIEERVFHTLVEVQLKYLPDRKRDLRLYNIY
ERNFELLFRTYSSKMMIDVPTVADKAAIAAMQSENDGEVAAWTGDCLENVIDFATALCAR
NAAFCCSFWRGTNEELDFHDSNGSGTGNNAGDEPEPLSSSVDDGNCHDFLLACRDAAFKN
PGCIASYLRLVAAAGSGPECAQQAFHHIKKNPQQLGWDQFFAVMAKYQRLLTEAEKPTGY
SPLGVAQGVGIDGSTFGSVSSAANPGPRFIRPKELEALETIQKLIQEVISDPQLALIFFH
NHDWSPIPTFVAFLQCRIPSSLKGSIMKTLAAFARVPDIAPFVWRQVDALQILRTTGDTS
VYGTQDISYELEHYESLSRTYPATRGFVTLLYELFENPHAWKSFEGDGRVAAIQFYFEFL
LEHVILKFDLRKYEREEEKWALVNGALAIFKKILRNVDTSTTEGSLSYQLLARFLSSNSL
LNKVLSILSGDGGVENLESTSTDMHLEHAFFYCLDIVKRETEAKHGSLNFVIDVSKKPSD
TYLTKTTAVAALRERCVQHALEIVVLVLEKDVQFVNIDLNRQLSLRLQVEMMHTILCRHR
ADFVNIVKYIKYSKSTHIPHLSAVILRMISARMSGTDLVDLLIDSGSSADIMIGYMNRLL
NVYDDDENDQDENETGTGTEDELHSSGRRKHQDTRTLSSPFELFTQETPPPSIRAAILDL
LLENLNKPAPNLAHLLLGNVNQYGDSKAGPVPTSYMKTGLAALITLVSNADFGLETPELA
ERCYHVLHSLITQEFSSPNTIAALESVPNDYFASQIQLFSRVYHVTRRKTAAATIAELNM
RGWFFKTLAVYLHVGLHKEPPHMKKINKLMGQLLSVSTGSRNDRVIARQEQMLLLQLLDE
CSFHISPPPVPANQQVVALAEQVTAAVEQGCYYKWLRIDVERFCQALQTLDLTATEDGMG
DYYSSSSKRFRVNGDGTSSTSSQNSTEAAAERFIQWAVQWNIYSERISAESHALNSLREL
MEVIVLDYLALSREQEGLETPAMWQGLDAVASAEVRQELMSGIVSAVLSKLIEKTSASAQ
LFEIVSRIALMLFSQLSYNNDGSQPHALPESRQRQNMGFLELLFRSIYSSAAATGNPSAA
RNSRTLLYSCTVQVLHVLPSRAAQDSAAKFGLASSILSQEQRVRHLLTNQVVDLVCRDAS
DGEDTLSMALAVSALESLIAFDDQSSLVAIFRERGYLLHFIDIFKKLSEMDAAAFERSNG
DASMVKSSVIPEGMDATTIGTMYECFLSLFARVAETQEGAVALLEGGLVRVLSDARNLPT
HRPQYLAPHNGTPSSEASVAAFQRVETVYYRKWAPVARLLSACCASLPKNRALTSQVLYF
VNKNRKLFTSALKLCAGGQQSQPTSVNLLRELSYVTFVFRYVTQFPDLCEQTLATAKWEK
ISQLILQVFLFYSAELAPPSDEADGMSDSGSSWWNNKITDSVEEQRNAAIQRFSCVDYEE
KILDKCDAAAVKASGSAGLLHMSMLDEEKLYASRMILCNAVAFCASRMMLAVGDGNAGRA
APLLAITNKTQVQNRNQFPSMSSVDPRAFAAATDPLWTLAPSLNDFTARFDSTVFALETS
KQLVDALAAFKTEAASARATSVSSASSQQRSLRRREPQYDTTTLENVLEYHADSLAFVVE
NMLVVLLLHFVHYLSHPEAASSKSTVHQALGKVLGVVSDIESNSFAHAIARRLRELASNS
NT seq 6303 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagagcctgtcgctcgcggatgcgccagcgctgcgcttccggcagctgcaccag
gatctgctggcctttgcggggcagagcatgtcggacgatgatgcaccgcagtatatggcg
gagctagtggctgctgctccggagctgttgcagcctctggccttggcgccacctagcgct
tcggagcgcgcggcacttcaagccaacacggtcaacgtcgccggcaagcacgtagacgtg
tcgccactaatccagcaagagatttgcaaactcagtgacgaatttcgcgccagcgagaag
acgtgctttgagttttggctgatggccagcgagcagcaacagcgcgagtgggttgaacgt
gcggaccagctccctcctggcactattgcgaactcggtacagaacgcagcgcgctacttc
ctgacctcagagacggaatacaagctgcatctcctcaaggagttgctgcgcctgcgactc
gagacgcagctggacaagcagcgtgcgcagttcatcgtgtcgtttactaacaagctactg
acggaggagttgctgaccaacttggtgacagcgtttgacactcagctgacacagcttgta
caagtagccaggatggagcagagtgtgagctattggcacacgctggtggcggattgcctg
gtgtttatcgtatccagcacgctgacattggcaaaagaagtgcagaagcttgcggaatta
ttgaagacgttgtgtggacgcttaaaaactgtggtggccaaggtgtcgccgcatattgtg
aacctctcgtcgttcgcgcagctgtttgaaggtggatcactagcaggaacgtcgccggaa
ggggcagtgagacaggtgtcctgcatgctgcagactattacggcagttcaggtggcgctt
ttcgtggttttgcttcagaaaagcaggaaaatggatcgcgaaactggtgacatggagatg
ggcatttctttgtgccgacgagaacacgcttcagtggtgacggagctgcaccgcattttt
ttcgtggaggaatgggaacagcggggtcttcagagcgtcgcaatgcttatgtgggctggc
ttcctggctggtaacaataatgataacagcagtaacagtaacgtgagctttgctgaggca
gatgatgcaacaagcgtagtcaaaaaggcaatcgaagagcgcgtgtttcatacgttagtt
gaagtgcagctaaagtatctaccggatcgcaagcgtgacctgcggctgtacaacatttac
gagcggaactttgagctgctgttccgtacttattcgtcgaagatgatgatcgacgtgccg
actgtcgctgacaaggctgctattgctgctatgcaatcggaaaatgacggtgaagtagcc
gcttggactggcgattgcctcgagaatgttatcgactttgcgacggcattgtgtgctcgc
aacgcagcgttttgctgctcattttggcgtggaacgaacgaggagctcgactttcatgac
agcaatggcagcggcaccggaaacaacgcaggagacgagcccgagccactctctagcagc
gttgatgatggaaactgccacgatttcttactcgcttgtcgtgatgctgcgttcaagaac
cctggatgcatcgcgtcgtacctgcgtctggtcgctgctgctggtagcggaccggagtgc
gcgcagcaggctttccatcacatcaagaagaacccacagcagcttggttgggatcagttc
tttgctgtaatggcaaagtaccagcgacttctaacggaagctgagaagcccaccgggtat
tcgccacttggtgttgctcagggagttgggatcgacggcagcacctttggcagtgtgagc
agcgcagctaatcctggtccccgatttattcgccccaaggaactggaagcattagaaacc
attcagaaactgattcaggaagtgatttcggaccctcagttggcgcttatcttcttccac
aatcacgactggtctccgatcccaacgttcgtggcttttcttcagtgtcgcattcccagc
tcgctcaagggatcaattatgaagacgctagctgcctttgcacgtgtgccggatattgcg
ccatttgtgtggcgccaagtagacgcgttgcagattctacgtactacgggggacacgtcg
gtgtacggcacccaggatatcagctatgaactcgagcactacgagtcactgagcagaaca
taccctgcgacaagaggttttgttacgctactctacgagctctttgagaaccctcacgcc
tggaagtcgtttgaaggcgatggccgtgtcgcagcgatccagttctacttcgagttcttg
ctcgagcacgtgatcttgaagtttgatttgcggaaatacgagcgggaagaagaaaagtgg
gcgctggtgaacggcgcgctggccatttttaagaagatcctgcggaatgtcgacacttcg
acgacggaaggtagcttgtcataccaacttctggctcggttcttgtcgagcaactcattg
ctgaacaaggtactgtctatcctctcgggcgatggaggtgttgagaacctagagagtacg
tcgacagacatgcatctcgagcacgccttcttttactgtctggacattgtcaagcgtgag
acggaggccaagcacggctcgctgaatttcgtcattgacgtttcgaagaagcctagcgac
acgtatctgaccaaaactacggcggttgctgccttgcgcgagcgttgtgtgcaacatgca
ctcgaaatcgtggtcttggtgctggagaaggacgtacaattcgtcaacatcgacctgaac
cgccagctttcgctccgcctccaagtggaaatgatgcacacaatcttgtgtcgtcaccgc
gctgactttgtgaacattgtcaagtacatcaagtactccaagtcgacacacattccacac
ttgtcggcagtgattctacgtatgattagtgcgcgtatgagtggaacggatctcgtggat
ttacttatcgacagtggatccagtgcagacatcatgatcggctacatgaaccgcttactg
aacgtgtacgatgacgatgaaaacgatcaagatgagaacgagacggggactggcactgaa
gacgagttgcactcatctggaagaaggaagcaccaagacacgcgcactctctcgtctccg
ttcgagttatttacccaagaaacgcccccaccctccatccgcgccgccattctggacttg
ctacttgagaatttgaacaagccagcgcctaacttggcacatttgctgctaggcaacgtc
aaccaatatggcgactcgaaggctggacctgtgccaacttcgtacatgaagacaggtctc
gctgctctgattacgcttgtgtccaatgcagattttggcttggagacgccggagttggca
gagcgatgttatcacgtgctccacagcttgatcacgcaagagttctcgtctcctaacact
atcgcagctctggaaagtgtcccaaatgactatttcgcatctcagatccagctgttcagc
cgtgtgtaccatgtaacgaggaggaagacggccgctgctacgattgctgagttgaacatg
cgcggatggtttttcaaaacgctagcggtgtacttacatgtgggactacacaaggagcct
ccgcacatgaagaaaattaacaagctgatgggacagttgctgtcggtatcgacaggcagt
cgcaatgatcgtgtcattgcgaggcaagaacaaatgctgctgctacagttgctggatgaa
tgctccttccacatctcgccaccccccgtaccggcgaaccagcaggttgtggctttggct
gaacaggtgactgcagctgtggagcagggctgctactacaagtggctaaggatcgatgtt
gagcgcttctgtcaggcattgcagacgcttgatctgacggcaactgaggatggaatgggc
gattactactcgtcgtctagcaagagattccgtgtgaatggcgacggtacaagcagtacc
agtagtcagaacagcaccgaagcagctgcggagaggttcattcagtgggctgtgcagtgg
aatatctactcggagcggatctctgccgagagtcacgcgctgaattcgctgcgtgagctg
atggaggtgattgtgctggactaccttgccctgtctcgcgaacaagaaggccttgaaaca
ccagcgatgtggcagggactagatgctgtcgcatctgctgaagtgcgacaggagctgatg
agtggcattgtgtcggctgtgctgagtaaactgattgagaagaccagtgcttctgcccag
ctatttgagatcgtctcgaggatcgcgttgatgctcttctcgcagctcagctacaacaat
gacggcagtcaaccgcacgcgctgccggagagtcgacaacgtcagaatatgggctttctg
gagctgctgttccgttctatctacagtagcgcggcggcaactggaaacccgtcagctgcg
cgtaattctcggacattgctgtactcgtgcaccgttcaagtgctgcatgtgctgccaagt
cgtgctgctcaagattctgctgcgaaatttggccttgcgagctcgattctcagccaggag
cagcgtgttcgacatctgctcaccaaccaggttgttgatctggtatgccgagatgcaagc
gatggcgaggacacgctgagtatggcgcttgctgtgtcggcgctagagtctctgatcgct
tttgatgaccagtcgtcgcttgttgcgatcttccgtgaacgtggttatctgctacacttt
atcgacatcttcaagaagctcagcgagatggatgcagccgcttttgaacgaagcaatggt
gacgcgagtatggtaaaaagcagtgtgatccccgagggaatggatgctacgacgatcggt
acgatgtatgagtgtttcctgtcgctgttcgcgcgagttgctgagacccaggaaggagct
gtggccttgctggaaggcggcttggtccgtgtgctgtctgatgcacgcaacctgccaaca
caccgaccgcagtatctcgctccacacaacggtactccgtcgtctgaagcatccgtggct
gctttccagcgcgtggagactgtatactaccgcaagtgggctccagtggcgcgtctactg
agcgcatgttgcgcctcattaccgaagaaccgcgctcttactagccaggtgctttacttt
gtgaacaagaaccggaagctgttcacgtcggcactgaagctgtgcgcaggtggtcagcag
tcgcagccgacctcggtgaatctactacgagagttgtcgtatgtgacgtttgtcttccgc
tacgtgactcagttccctgacttatgtgaacaaaccctggcgacggcgaagtgggagaag
atttcgcagttgattcttcaggtcttcctgttctatagcgctgagcttgcacctcccagt
gacgaagccgatggaatgagcgacagcggttcttcgtggtggaacaacaagatcacggac
tcggtggaggagcagcgcaacgcagccatccagcgtttctcgtgtgtggattatgaagaa
aagattttggacaagtgtgatgcggcggccgtgaaggccagtggaagtgctggcttgctg
cacatgtccatgctggacgaggagaagctgtacgcgtctcggatgatcctgtgtaatgct
gtggcgttctgtgcgagtcggatgatgcttgcagtgggcgatggaaacgctggtcgggca
gctccgttgttggccatcacgaacaagacacaagtgcagaatagaaaccagtttccatcc
atgtcttcggtggacccgcgcgcgtttgctgctgctacagacccgttatggaccctcgcg
ccgtcattgaacgactttactgcgcggttcgactccaccgtgtttgctctggagacgagt
aagcagctagtggacgctctggctgctttcaagactgaagctgcttcggctcgcgccact
tctgtttcgtcggcgtcgtcgcagcaacgttctcttcgtcgacgcgagccccagtacgac
accacaacgctggagaatgtattggagtaccatgccgacagcttggcgttcgtagtagaa
aacatgcttgtggtgctgttgcttcacttcgtacactacctgagtcaccccgaagctgca
tccagcaagagtaccgtgcatcaagcactcggcaaagtgcttggcgttgtcagcgacatc
gagagtaattcattcgcccacgcaatcgctagaagacttcgcgagttggcgtcgaacagt
tag

DBGET integrated database retrieval system