KEGG   Phytophthora infestans: PITG_06482Help
Entry
PITG_06482        CDS       T01333                                 

Definition
eukaryotic translation initiation factor 3 subunit, putative
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
pif  Phytophthora infestans
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pif00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PITG_06482
Translation factors [BR:pif03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    PITG_06482
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 696 aa AA seqDB search
MAPTTFEQKVAQLKREAEHYADYLSDEEVEDEVTTKAHEEADFCNDYSMAVVVGGLPVID
KTKHGKLLNVVKKIFGQVGTVVDIQMPFGANGKTTGFAFVEYEQEAHANDAVRTINNFAL
DKRHTMLVNRYEDIERYQKTPTEFVAPKVEKFVEPKNLKTWLTDPARRDMFVLRHGSETE
IFWSDKGELELDYAGDREKTNGKQWCSQYVLWSPQGTYLATFHPQGIALWGGDKYEKVGR
FAHKNVKLAVFSPNENYLITLSETEQDAAIIIWDVKTSKMLRAFPAGKSSGEKGEVVQGL
MTPFKWSADEKYVARRGKDVISIYELPSMKLLEKKSLRAEGVHDFFWSPTDPILAYWAPE
GNNVPARVSLVELPSRREVRQKNLFNVSDCKLHWHSNGTFLCVKVTRHSKSKKTMYTNFE
LFRVQDQQVPVEMLEVKENIVAFAWEPKGTRFATVHGEGQQRLNVSFYDMDGGSKAAKEV
TLLYTLKDKACSHLYWSPLGNNIVLAGLGEINGQLEFWDATEQQSITVQEHFKCTHVEWD
PSGRVVATAVCQPLDNSYYKFTMDNGYTLWTFQGKQLLEEKKDAFYQFLWRPRPRTLLSD
KQYNNVVKNLKKFEKRFDQMDRLKERERLSAEKAERNRKEQEFQDLLQKRLVTAAARRAE
YIALLDGYDSEDESEYIVQSHTYDDVLEVKEEAMRK
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccacgacgttcgagcagaaggtagcgcaactgaagcgcgaggcagagcactac
gctgactacctaagcgacgaggaagtcgaagatgaggtgacgaccaaagcacatgaagag
gcagacttctgcaacgactacagcatggctgttgtggttggtggccttcctgttattgac
aagaccaagcacggcaagcttttgaacgtcgtaaagaagatcttcggccaagtgggcacc
gtagtagacatccaaatgccgtttggcgctaatggcaagaccacgggcttcgctttcgtc
gagtacgagcaggaggctcatgccaacgacgctgtgcgcactatcaacaactttgctctg
gacaaacgccacacgatgctcgtgaacagatacgaggacattgagcgctaccagaagaca
ccgaccgagtttgtcgcccccaaggtggaaaagttcgtcgagcccaagaacctcaagacg
tggctcacggaccctgcgcgtcgcgacatgttcgtgctgcgtcacggctccgagaccgaa
atcttctggagcgacaagggcgagcttgaacttgactacgctggagaccgtgagaagacg
aatggcaagcagtggtgctcgcagtacgtgctgtggtctcctcagggcacgtacctggcc
acgttccacccgcagggtatcgctctatggggcggcgacaagtacgagaaggtgggtcgc
ttcgcccacaagaacgtcaagctggctgtgttctcgcccaacgagaactacctcatcaca
ctgagcgagacggagcaggacgcggccatcatcatctgggacgtcaagaccagcaagatg
ctgcgcgccttccctgccggcaagtccagtggcgagaagggtgaagtggtgcaaggtctg
atgactccgttcaagtggagtgctgacgaaaagtacgtggctcgtcgtggcaaggacgtc
atcagtatctacgaactgccgtccatgaagctgctggagaagaagtcgctgcgtgccgag
ggcgtccacgactttttctggtcaccaactgacccgatcctcgcgtactgggcccccgag
ggcaacaatgttcctgctcgtgtatcactcgtggagctgccatcgcgtcgcgaagtgcgt
cagaaaaacctattcaatgtgagcgactgcaagctgcactggcactcgaacggcacgttc
ctgtgtgtgaaggtgacgcgtcactccaagtcgaagaagaccatgtacaccaacttcgaa
ctcttccgtgtgcaggaccaacaggtgccagttgagatgctggaagtcaaggagaacatt
gtggcgttcgcttgggagcccaagggcacacgcttcgccactgtgcacggcgaaggtcag
cagcgtctgaacgtgtcgttctatgacatggacggcggtagtaaggccgcgaaggaggtg
actctgctgtatacactcaaggacaaggcgtgtagccacttgtactggtcgccactgggc
aacaacatcgtgttggctggtctgggcgagatcaatggccaactggagttctgggacgct
acggagcagcaaagcatcacggtgcaagagcactttaagtgtacccatgtcgagtgggac
ccgtctggacgtgtggtggccacggcagtgtgccagccgctagacaattcgtactacaag
ttcacgatggacaatggctacacgttgtggacattccagggcaagcagctcctggaggag
aagaaggacgcgttctaccagttcctgtggcgtccgcgtccgcgtacgctgctgtcagac
aagcagtacaacaatgtggtcaagaacctcaagaagttcgagaagcgcttcgaccagatg
gatcgtcttaaggagcgtgagcgtctgtccgctgagaaggcggagcgcaaccgcaaggag
caagagttccaggacctcctgcagaagcgtctggtcacggctgccgcgcgccgtgctgag
tacatcgcgctgctggacggctacgatagcgaggacgagagcgagtacattgtgcagagt
cacacgtacgacgacgtgctggaggtgaaggaggaggctatgcgcaagtaa

DBGET integrated database retrieval system