KEGG   Phytophthora infestans: PITG_06693Help
Entry
PITG_06693        CDS       T01333                                 

Definition
(RefSeq) trifunctional enzyme subunit alpha, putative
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
pif  Phytophthora infestans
Pathway
pif00062  Fatty acid elongation
pif00071  Fatty acid degradation
pif00280  Valine, leucine and isoleucine degradation
pif00310  Lysine degradation
pif00380  Tryptophan metabolism
pif00410  beta-Alanine metabolism
pif00640  Propanoate metabolism
pif00650  Butanoate metabolism
pif01040  Biosynthesis of unsaturated fatty acids
pif01100  Metabolic pathways
pif01110  Biosynthesis of secondary metabolites
pif01130  Biosynthesis of antibiotics
pif01200  Carbon metabolism
pif01212  Fatty acid metabolism
Module
pif_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
pif_M00085  Fatty acid biosynthesis, elongation, mitochondria
pif_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PITG_06693
   00650 Butanoate metabolism
    PITG_06693
  Lipid metabolism
   00062 Fatty acid elongation
    PITG_06693
   00071 Fatty acid degradation
    PITG_06693
   01040 Biosynthesis of unsaturated fatty acids
    PITG_06693
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PITG_06693
   00310 Lysine degradation
    PITG_06693
   00380 Tryptophan metabolism
    PITG_06693
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PITG_06693
Enzymes [BR:pif01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     PITG_06693
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PITG_06693
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 AlaDh_PNT_C NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 9472428
NCBI-ProteinID: XP_002998772
UniProt: D0N5G7
AA seq 727 aa AA seqDB search
MVLQTTSILRRVALSARLASSRALSSAASSSGAFLTMETRSNGVAIVRLDDKAAKNDPNI
KSVVLISAKPGVFIAGADIAELNACKTEEEMRAMSSAGQAFMNRLADSKKPFVAAIEGSC
MGGGLEVALACHYRVAAQSKKTQLALPEVMLGLLPGAGGTQRLPALVGIQASLDMMLTGK
NIKPDKALKMGLVNQVADPFALESAAISAAEQLAAGSLKPKKKSKGLVNRILEDTPLRQV
VFNKAGEMVEKKTGGHYPAPKLILEAAQTGIEQGLTKGLEVEASNFAKLGMTSEAKALMS
IFFGQTALKKNRYGKPAKPVETMAVVGAGLMGAGIAQVSAAKGVRVLLKDRDAAAAAKGE
DYVRNNLDQKVKRKRMTIYDRDAVMANVVPLSDEDDVWKTHIKKADLAIEAVFEDLALKH
KVLSDLENYVSKDCVIATNTSALPIADIASACRRPENVIGMHYFSPVPSMPLLEIIRHAG
TSDATASKAVDLGLRQGKTAIVVKDVPGFYVNRCLGPYIAETLALVGDGVEPEKLDKLMT
KWGLPVGPITLADEVGLDVAYHVNQTLSKALGVRMGGGDAKLFEEMIEQGFLGKKSGKGF
FVQPPKGKKGKKTLNADAMNLIKKFQKQDLKLSDEDTVNRLISRFVNEAVLCVQDEIIES
PSEGDIGAVFGIGFPPFVGGPFRYVDKVGSTKFTEMMQRYADQYGPQFAPAPLLEDMAKT
NKKFHSK
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggtgcttcagacgacctcaattcttcgtcgggttgcgctttctgcgcgcctggcgtcc
tcgcgcgcactgtccagtgctgcctccagctcgggcgccttcctgacgatggagacgcgc
tccaacggcgtggcaattgtgcggctggacgacaaagcggctaaaaacgaccccaatatc
aagtctgtggtgctcatctcagctaagcctggtgtgttcatcgctggcgctgacatcgcc
gagcttaacgcgtgcaagacggaggaggagatgcgtgccatgtctagcgctggccaggcc
tttatgaaccgcctggctgactctaaaaagcccttcgtggcagccatcgagggctcctgc
atgggtggcggcctcgaggtggcactcgcctgccactaccgtgtggctgcgcagagcaag
aagacgcagttggcgctacctgaagtcatgctggggcttttgccaggcgcaggaggcact
cagcgtctgccagcgcttgtgggcatccaggcctcactggatatgatgctcacgggcaag
aacattaagcctgacaaagcccttaaaatgggcctcgtgaaccaagtggccgacccattt
gcactcgagagtgcagccatctcagcagctgaacaactggctgcaggcagtctgaagcct
aagaagaagagcaaaggactggtcaatcgcatattggaggatacgccgctgcgtcaggtt
gtcttcaacaaggccggggagatggtggagaagaagacgggaggtcattaccccgcgccc
aagctcattctggaggccgcacaaacggggattgagcaaggtctcacgaaaggtctggag
gtcgaggcttccaattttgccaaactggggatgaccagcgaggctaaggctctcatgagt
atcttcttcggacagacggctcttaagaagaatcgctatggcaaacctgcgaagcctgtg
gagactatggcagttgttggtgctggtctcatgggagctggcatcgcacaagtgtctgct
gctaaaggtgtgcgtgtcctgctaaaagatcgcgacgctgcagctgctgcgaagggagaa
gactacgtacgcaacaatttggaccagaaggtgaagcgcaagcgcatgacaatctacgat
cgtgacgctgttatggccaacgtcgtgcctctgtctgacgaggatgatgtctggaaaacg
cacatcaagaaggcagatctcgctattgaggcagttttcgaggacttggctctcaagcac
aaggttctgtcggatctggagaactacgtgtcgaaagattgcgtcattgctactaataca
tcggcgcttccgatcgctgacatcgcgtcggcctgcaggcgaccagagaacgtgatcggc
atgcactacttctcacctgtgcctagtatgccgttactggagatcattcgtcacgctggt
acgagcgatgcgactgcttcgaaggctgtggatctgggactgcgtcaaggcaagactgct
atcgtggtgaaggatgtgcctggtttctatgtaaaccgctgtcttggtccgtacattgca
gagacgctggcacttgtgggcgatggcgtcgagccggagaaactcgataaacttatgacc
aagtggggtcttcctgtgggccccatcacgctggcggacgaggtggggctggatgtggcg
taccatgtaaaccagacgctttcaaaggcgctgggtgtgcgtatgggaggcggcgatgcg
aagttgtttgaagagatgattgagcaggggttccttggcaagaaatccggcaagggcttc
ttcgtgcagcctcctaagggcaagaaaggaaagaagacgttgaatgctgatgccatgaac
ctcatcaagaagttccagaaacaagatctgaagctcagcgatgaggacacggtcaaccgt
ctgatctctcgtttcgtgaacgaggcagttctgtgtgtgcaagatgaaatcatcgagtct
ccatcggagggcgacattggcgccgtgttcggcattggctttccgcctttcgttggcggc
ccctttcgctacgttgacaaggtgggcagcaccaagttcacggagatgatgcagcgttat
gctgaccagtacggcccgcagtttgcccctgcacctctgcttgaagacatggccaagacg
aacaagaagttccactcgaaataa

DBGET integrated database retrieval system