KEGG   Phytophthora infestans: PITG_06749Help
Entry
PITG_06749        CDS       T01333                                 

Definition
bifunctional dihydrofolate reductase-thymidylate synthase 2
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
pif  Phytophthora infestans
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PITG_06749
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PITG_06749
   00670 One carbon pool by folate
    PITG_06749
Enzymes [BR:pif01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PITG_06749
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     PITG_06749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 509 aa AA seqDB search
MTEQSIRVVVAALETTGGIGLRQHIPWRLPSDMKHFRALTTASPDSSVQHAVIMGRKTWE
SLPAKVRPMPKRYNVVLTRDSSYRNKQEIPDTVGVAASFREALKLVQEQGDKVDQVFVIG
GGAVYAEALSYPSCTKVHLTRVKGQFECDAFFPLEQLEQNFKVAEESEVKEENGVQFHFV
EWERKTGEVKAVESALLVDNTTPHEEMQYLDLIRKILTQGAKREDRTGTGTLSVFGAQMR
FSLRNNVFPLLTTKRVFWRGVAEELLWFISGDTSAHTLQQKDIHIWDGNGSREYLDSRGL
QHREVGDLGPVYGFQWRHFGAKYTDMHADYTGKGVDQLAEVIHKLRTNPTDRRIVLSAWN
PSDLNEMALPPCHMFCQFYVANGELSCQMYQRSADMGLGVPFNIASYALLTRLVAQVTGL
KPGEFIHVIGDAHVYLNHVEPLQKQLTRTPCPFPTLHINPEKTSSIDEFTFEDFEWVSDY
AGSAIVLCKLSWSPSLVGVVYLVKADEGA
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgacggagcaatcaattcgtgtcgttgtggcagctctcgagaccacgggtggcatcggc
ctgcgccaacatatcccgtggcgccttccctccgacatgaagcactttcgcgcattgacc
acggcctctccggactcttcggtgcagcacgcagttatcatggggcgcaagacgtgggag
tcactaccagccaaggttcggcccatgcccaagcgctacaacgtggtgctgactcgtgac
tccagctacagaaataaacaagagatacctgatactgtgggagtcgctgccagctttcgt
gaggcgctgaagctcgtgcaggagcagggagacaaagtggaccaggtcttcgtcattggc
ggcggcgctgtgtacgctgaggctctgagctatccaagttgcactaaggtgcacttgaca
agagtcaagggccagttcgaatgtgatgctttttttccgctggagcaactcgagcaaaac
tttaaagtggcggaggaatccgaagtcaaggaggaaaacggagtgcagtttcactttgtc
gagtgggaaagaaagactggagaggtaaaagctgtagaatcggcattgctagtggacaac
acgacgcctcacgaggagatgcagtacttggacttgatccggaaaattctgacgcaagga
gccaagcgtgaagaccgcacaggaacgggcacgttgtcagtctttggggcacagatgaga
tttagcctgaggaacaatgtgttcccattgctgacaaccaagagggtcttttggcgaggt
gtagccgaggagcttttgtggttcattagtggcgacacgagtgcacacactttgcagcag
aaagatattcacatctgggacggtaatggatctcgcgagtacctggatagtcgaggactt
cagcatcgggaggttggtgaccttggacctgtttacggctttcagtggcgccactttggc
gccaagtacacggacatgcatgcggactacactggcaaaggcgtggaccagcttgctgag
gtgattcacaagctgcgtacgaatccgactgaccgacggattgtgctctcggcgtggaat
ccctcagatctcaacgagatggcactgccgccgtgccacatgttctgccagttctacgtg
gccaatggggaattgtcttgccaaatgtatcagcgctcggccgacatgggacttggtgta
cctttcaacatcgccagctacgcgcttcttacgcgactggtagcacaagtgacaggccta
aagcctggcgagtttatccacgtcatcggtgatgcacacgtgtatctaaaccatgtggaa
ccgcttcagaaacagcttacgcgtacaccgtgcccgttcccgacacttcacatcaaccct
gaaaagacctcaagcattgacgaatttacgtttgaggacttcgagtgggtgtcagactac
gctggtagtgccattgtgctttgcaagctgtcgtggtctccttctcttgtcggggtcgtg
tatcttgtaaaagccgacgaaggagcttag

DBGET integrated database retrieval system