KEGG   Phytophthora infestans: PITG_06821Help
Entry
PITG_06821        CDS       T01333                                 

Definition
(RefSeq) eukaryotic initiation factor 4E, putative
  KO
K03259  
translation initiation factor 4E
Organism
pif  Phytophthora infestans
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:pif00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PITG_06821
Messenger RNA biogenesis [BR:pif03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     PITG_06821
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     PITG_06821
Translation factors [BR:pif03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    PITG_06821
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 206 aa AA seqDB search
MSNNATFDLGKIDNTSFVSDFIKYRYDKKMPKKIDVGTYQSNLQKIANFNTVEDFWRHYI
HVKRPSQLSRDVNLYLFRDQPNCAPMWEAFPQGGCWILKIKKKANVLGKMWQDLVFAAIG
EAFEQLDVVGIAMAIRSKEDMLSVWNADNSDDNTRFAIGEKLKEILMLDSNTLVEYKFHA
NSIRDMSTFRNAKPYVFAAATPATTN
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaacgccacatttgatttgggcaaaattgacaatacttcctttgtgagcgat
ttcatcaaataccggtacgacaagaagatgcccaagaagattgacgtgggaacttaccag
tcgaacttgcagaagattgccaatttcaacacggtggaggacttctggcgccactacatc
cacgtgaagcgtccgtcgcagctgagtcgtgatgtgaacctttatctgttccgtgaccag
ccgaactgcgcgccgatgtgggaggctttccctcagggtggctgctggatcctcaagatc
aagaagaaagccaacgtactcggtaagatgtggcaggacctggtctttgccgccattggt
gaggctttcgagcagcttgacgtcgtgggtatcgccatggcgatccgctctaaggaggac
atgctgtctgtctggaacgccgacaactcggacgacaacacccgctttgctatcggtgag
aagctgaaggagatcctcatgcttgattccaacacgctggtggagtacaagttccacgca
aactccatccgggacatgtcgaccttccgcaacgcgaagccctacgtcttcgccgctgcg
acgccggccacgaccaactaa

DBGET integrated database retrieval system