KEGG   Phytophthora infestans: PITG_06832Help
Entry
PITG_06832        CDS       T01333                                 

Definition
ubiquitin-specific protease, putative
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.1.2.15]
Organism
pif  Phytophthora infestans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1769 aa AA seqDB search
MDNSTEPTEPLAPSSTPPILRKSSSLPAYDLALRGDDSDAANSSGDDSARVASIAEEDDV
VSLSSASELSLRGGKGETAKDTVPQLPKVGSARSAPTLERSHTSSELIGLRSRERQTNES
AYSSPSSGSAPSFEIESVTLPTDGVTETEIDKTTHTVFSIEVRLQGGLQWLIRKRYSDFR
ELHDRLKRTSSPVKQLYFPKRHVFRNRHQSVVEQRRSELEKYINEVLDIRPLIRVPLFNF
LEVYAHMESYERKLQRHKKELESERMKNMLPSELLDDFSAAFKRLCSSKYLYHGSTSGGH
KPEAEPSRGSASSAPTSSGGRPPTSPAKDVTTSTSTGEPSKGSTTDENGNRHSVIMHTAG
SQICISRASFRRDILGVFPDMPSSFAMRFMKTVSDRQGSDINMDEFLRAVAVLNCGTMED
QLKFIFNMCDLDHAGKVQSTGLSNFLVSLHGRNVLDRPEYRRLLSEGFDQGRVRMSCDDF
IKIVPELKAYHTLVDWMAPFADILCETANPQLLESQEEFNPVVQQKILANETHFTAKEVA
VLQDAFNNYRASGGGDAVDVDALTSDFPLEMSEDRFCRVFTSFGSRANGSEIDVFSFVSA
LSIACRGITKEKAEFAFKLFASVEDGSYMTREDIYSMLRLDITQNPELESQITALIEKKH
PSLNATKSSSSSSLIESMEPRTPSVSGSELGIFVDGIMKGFGKRRRVWDASSSSAQTEAL
TLTLDEFTAWAIKQKYEMATLRIMREVAFIDLGLVPATKEEELLIATGCYTPYDPTTLVE
DDRWYLLERKWYIHWCRYIKIHVKESLALSPPVSNPPTSNTSTSTPSTSKVQVNGGSTSN
KDNYMKNLKGEIIRPKCINNYPLLTSDRRDRILKTSDEIKLGRHYIIIGEQLWMALKLWY
GKSGTKKKLLKKKSKSKGTDTDMEEEDDDDDVEDDASSVPSEEENRRKQELALPRRMRSG
GSVGLANLGNTCYMNSALQCLTNTKLLAEYFLSGMYLEDINRTSTLGLQGKLAEVYGKLA
EDMWCVKQKSISPRNFKKSIGKFNEVFRGNDQQDAQELLAFLLSGLSEDLNRIQDKPYIE
QPDSDGRYDADLADEWWRNHLRREVSIIVALFTGQYKSLLTCSVCGFKSARFEPFTFLQV
PLPEPKHNTVTVQLMLANGVTPMKVSVRLSISATIFDLKHELMKMCREEFDLADVTESDI
KLCEFSGSMILSFKADNRRVGQIRSIDRLIAFQLEPLDPETIQATRHRRPSYVQTVGSGS
LRPDETDHSAFYEKLTKGVLVDVRMRTQTHEYIPAVVLEAPTAHADYEDQPVVLVRLRRT
EDEIKVPLNRLRPRQARLLYIPLLSRKLSYSAVYFKNPFRPVPFGSPNLVRLCPELTSGL
QLYQLVWERVKQYVGPDAKPPTEWDEDETRNADRLVANHIDSVFAGLDDASVVFSSKCGF
LLRRVENKGLTDSRSSWLTRSFGLTVPCTSEPLDILEEEAIAIDWDLSVFQDRETMDTMK
HVENHESVARNEAIDKGPVPLKHCLDAFTSEEKISEGYCSSCRKHQEMTKKLEIWRLPPV
MVVHLKRFQYTQTYRRKLASLVEFPIHDLDLQCCVAPHFEIPEKYPMKRFKSTSSGLSAP
ARKLMKLRSRGGSTAREKPEDKSSSPDAKADSTATTDTEATSTTTTDSHRAFAAQAQQRW
ATAYFLAVWITGWARLLIEWYYYDDERVRVVEDQQVVSPSAYLLFYLRSDMEGVLVKDLF
PKNMKPGKITDEDIERFVEEGDERRCNIM
NT seq 5310 nt NT seq  +upstreamnt  +downstreamnt
atggacaactcgacggagccgacggagccgctagcgccgtcgtccacgccgccgatattg
cgcaagagctcgagcttgcccgcgtacgatctggcgcttcgtggagacgactccgatgcg
gccaacagtagcggtgacgacagcgctcgtgttgcctccatcgctgaggaagatgacgtt
gtatcgctctcttcggcgtcagagctcagtctgcgcggcggtaagggggagacagccaag
gataccgtgccacagctgcccaaagtaggcagtgcgcgctccgccccgacactcgagcga
tcccacacgtctagtgaactcattggccttcgctctagggaaagacaaacgaacgagtcg
gcctattcgagtccgtcctcaggatccgctccgtctttcgagatcgagagtgtgacgctc
cctacggatggagtcaccgagacggagattgacaagacgacccacaccgtcttctcaatt
gaggtgagactgcagggaggactgcaatggctcattcgtaagcgctattcggactttaga
gagctacatgatcggctcaagcgaaccagctcgcccgtcaagcagttgtactttcctaaa
cgtcatgtgttccgcaatcgccatcaaagtgtcgtggagcagcgacgtagtgagctggaa
aagtacattaacgaggtgttggacatccggccgctcatccgagtccctctgtttaacttc
ttggaagtgtacgcacacatggagtcgtacgaacgcaaactgcagcgacacaagaaggaa
ttggagtccgagaggatgaagaacatgctgccatcagagctgctggatgatttctcggct
gccttcaagcggctttgctcctccaaatatttataccatggaagcacttctggtggacat
aagccggaggctgagccctcgcgtgggtctgcaagctcggcgccaacttcgtcgggagga
cgccctccgacgtcaccagcaaaggatgtgacgacctcgaccagcactggagaaccttcg
aaaggcagtactacggatgagaatggcaaccgccacagtgtcatcatgcacacggctgga
tcacagatctgtattagccgcgcttcctttcgtagggacatcctcggtgttttcccggac
atgccgtcgagcttcgctatgcgctttatgaaaaccgtatccgatcgtcaaggctcggac
attaacatggacgagttcctacgtgccgtggcagttttaaactgcggtacgatggaggac
cagctcaaattcatcttcaatatgtgcgatctggatcatgcaggaaaagtgcagagtaca
ggactcagcaactttctggtgtcacttcatggaagaaacgtgctggatcgaccggaatat
cgtcgtctgttgagtgaaggcttcgatcagggtcgagtacgcatgagttgtgatgatttt
atcaagattgtcccagaactcaaggcatatcatactctagtggactggatggcgcctttt
gccgatatattgtgcgagaccgccaatccacagttgctggagtcacaggaggagttcaac
cctgtcgtacagcagaagatcctcgctaatgaaacgcactttactgcaaaggaggtggct
gtcctgcaggacgcctttaacaactatcgcgcctccggaggcggtgatgccgtggatgtg
gatgcacttaccagtgacttccctttggaaatgtccgaggatcggttttgtcgcgtgttt
accagctttggctcgcgtgcgaatggatctgaaattgacgttttcagcttcgtaagcgcg
ttgtcaattgcttgccgaggcattacaaaggagaaggccgagtttgccttcaagcttttt
gcaagcgttgaggacggctcgtacatgacgcgtgaggatatctacagtatgctgcgactg
gacattacgcaaaacccggagctggagagccagattacggctctcattgagaagaagcac
ccgtcgctgaacgccacgaagagctcatcatcttcgtctctgattgagagcatggagcca
cgaacaccgtcggtatcggggtctgaattgggcattttcgtcgatggtatcatgaaaggc
tttgggaagaggagaagagtttgggacgccagctcgtcttcagcacagacagaggctcta
actctaactctcgacgagttcacagcatgggcaatcaagcagaagtacgaaatggctacg
ctgcgaatcatgcgcgaggtggcgtttatcgatcttggtttggtcccggcgacgaaggag
gaagaactattaatcgcgacggggtgctacactccctacgaccccactaccttggtggag
gatgatcggtggtatctgcttgagcgcaagtggtatattcattggtgccgatacatcaag
atccatgtgaaggagtctctggcgctgtcgcctccagtttcgaaccctcctacgagcaat
acgtctacttcgactcctagcacgtcgaaggtgcaggtcaatggcggtagcacctccaac
aaggacaactacatgaagaacctcaagggagaaattatccgtccgaagtgcatcaataac
tatcctctgctcacgagtgatcgtcgcgatcgaatcctcaagacatcggatgaaattaag
cttggtcgtcactacatcatcataggcgagcagttgtggatggcgctcaagctgtggtac
gggaagtctgggacgaagaaaaaacttttaaagaagaagtctaagagcaagggaaccgac
acggatatggaagaggaagacgatgatgacgacgtggaagacgatgcatcgtctgttccg
tctgaagaggaaaaccgccgcaagcaggaacttgctcttccccgccgcatgcgatcgggt
ggctctgttggactcgcgaatctcggcaacacttgctacatgaactctgccttgcaatgt
cttacaaacacgaagctgctggctgagtactttctctccggaatgtatttggaggacatc
aaccgcaccagcacactgggactgcaaggtaagctagcagaagtctacggcaagctcgct
gaggacatgtggtgtgtgaagcagaagtccatttctccgcgaaactttaagaaatccatc
ggcaagttcaacgaagtattccgtggcaacgaccagcaagacgctcaggaacttcttgcg
tttctgctgagtggattaagtgaggatctaaaccggattcaggacaagccttacattgag
cagccggacagcgacggtcgctacgatgctgatctggctgacgagtggtggcgcaaccat
ctaagacgtgaagtatcgatcattgtcgcgttgttcacggggcagtacaagtcgctgctg
acatgcagtgtatgcggctttaagtcggcacgcttcgagcccttcaccttcctccaggta
ccgctaccggaacccaagcataacacggtgacggtgcagctaatgctggctaatggagtc
actccaatgaaagtgtctgtccgattaagtatctccgcgacgatctttgatctgaagcac
gagctgatgaaaatgtgccgcgaagagttcgatctggctgacgttactgagagcgacatc
aagttgtgcgagtttagcggatcgatgatcttgagcttcaaagcggacaaccgccgggtg
ggccagatccgcagtattgaccgactcattgcgttccaactggaacctttagacccagaa
acgattcaagccactcgacatcgtcgcccctcgtacgtccagactgttggatcgggtagt
ctacgaccagatgagactgatcattctgcgttctacgagaagctgactaagggtgtgcta
gttgatgtgcgcatgcgaacgcaaacacacgagtacatcccggcggttgtcttggaagcg
cctacagctcatgctgactatgaagaccaacctgttgttctagtacgtctccgtcgcaca
gaggatgagatcaaggtgccactgaatcgtctccgaccacgtcaagcacgactgctgtac
attccgctgctttcgcgtaaactcagctactcggctgtgtactttaagaacccgttcagg
cctgtgcctttcggttcgccaaaccttgtgcgactctgtccagagcttacgagtggcttg
cagctgtatcagttggtgtgggaacgcgtaaagcaatatgtgggcccggatgcaaaacct
ccaaccgagtgggacgaggacgagacgcggaatgccgaccgcctggttgctaatcatatt
gacagcgtgtttgcgggtctcgacgatgcgtcagtggtgtttagctccaagtgcggcttc
ttgctgcgtcgcgtggagaacaagggactgaccgattcgagatcatcgtggctgacgcgt
agtttcggattaacagtcccgtgcacatcggagcctttggacattctggaagaagaagct
attgcgattgactgggacctcagtgtgttccaagaccgcgagacgatggacacgatgaag
cacgttgaaaaccacgaaagcgtcgcacgtaacgaggctatcgacaaaggccctgtgccg
ttgaaacactgcttggatgcattcacaagtgaggagaagatcagcgagggctactgctcc
agctgcaggaaacaccaggaaatgacgaagaagctcgagatttggcgtctaccgcctgtg
atggtggtgcacttgaagcgtttccagtacacacagacgtatcgacggaagctcgcgtca
ctcgtggagtttcctattcatgacctggatctccagtgctgcgtggctccacattttgaa
ataccggagaaatatccaatgaagagattcaagagtacttcaagtggactgtcagcccct
gctcgtaagctgatgaagctcagatctcgtggcggaagtaccgctagagagaaacctgaa
gacaagtcgtcatcacccgatgcaaaggctgacagcactgctacgacggacaccgaggcc
acttctactaccacgaccgatagtcatcgtgcattcgcggcccaagcgcagcagaggtgg
gcaaccgcgtatttcctcgcggtttggatcaccggctgggcccgtcttttgatcgaatgg
tattactacgacgacgaacgtgtccgtgtggtagaagaccagcaagtcgttagcccgtct
gcctacttactcttctacctccgttcagacatggaaggcgtgctggtgaaggacttgttc
ccgaagaacatgaagccaggcaagatcacggacgaggacatcgaacgttttgtcgaggaa
ggagacgagcgccgctgcaacatcatgtaa

DBGET integrated database retrieval system