KEGG   Phytophthora infestans: PITG_07027Help
Entry
PITG_07027        CDS       T01333                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pif  Phytophthora infestans
Pathway
pif00630  Glyoxylate and dicarboxylate metabolism
pif01100  Metabolic pathways
pif01110  Biosynthesis of secondary metabolites
pif01200  Carbon metabolism
Module
pif_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PITG_07027
Enzymes [BR:pif01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PITG_07027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 9463827
NCBI-ProteinID: XP_002904993
UniProt: D0N726
AA seq 537 aa AA seqDB search
MSSPHVRISQIASHLSSHDPRAEESDYAQRVKQTEAFIRDERFQYVKRPYGAEDVVKLQG
TIPAANAGAAMSRKLYKMLRELQAAQKTSHTFGALDTIQVTQMAKHLSSIYVSGWQSSST
ASTSNEPGPDVADYPMDTVPNKVDQLFRAQLFHDRKQYEARRRMTAEERARTPPTDFLRP
IVADADTGHGGLTAVMKLTKMFVERGAAGIHLEDQKPGTKKCGHMGGKVLVSVQEHIQRL
IAARLQADILGSPLVIVARTDAEAATLLDNNIDPRDHPFIIGATNLNVETYIDATRAGRE
GDWDKRAHAMTYPEAVREALKKSGRSDALAKWNAQCLELSLPKLQVLAKSLGVNIAFDWD
LARTVEGYYRVRGGVEYCIARGRAYGEYADLIWMETAKPGVPLARTFAEGVKAKIPHQML
AYNLSPSFNWDAAGMSDTEIETFVTDLGRLGFCWMFITLAGFHSDSLGITRFARDYAKRG
MLAYVEGVQRAERNEGVETLKHQGWSGTDLVDAMQNTITGGLSSTNTMGHGVTEAQF
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgagctccccacacgtccgcatcagccagatcgccagccacctgagctcgcacgacccg
cgcgccgaggagagcgactacgcacagcgcgtcaagcagactgaggcatttatccgcgac
gagcgctttcagtacgtgaaacgcccgtacggcgccgaggatgttgtcaagctccagggt
accatccccgccgccaacgccggcgctgccatgtcacgcaagctatacaagatgctgcgc
gagctacaagctgcccagaagacgagccacactttcggcgcgctggacacgatccaggtg
acgcagatggctaagcacttgtcctccatctacgtcagcggctggcagtcgtcgtccacg
gcctccacgtcaaacgagcctggcccggatgtggccgactaccccatggacacagtaccc
aacaaagtggaccagctcttccgcgcccagctcttccacgaccgcaagcagtacgaggct
cgtcgccgcatgacggccgaggagcgcgcacgcacgccacctacggacttcttgcgtccg
atcgttgctgatgccgacactggtcacggcggtctgacggccgtcatgaaattgaccaag
atgttcgttgagcgtggtgccgctggcatccacctcgaggaccagaagcccggcaccaag
aagtgcggccacatgggcggcaaggtgctggtctcggtgcaggagcacatccagcgtctc
atcgctgctcgtcttcaggctgatatcttgggcagtccgctggtcattgtagctcgtaca
gatgcagaggctgctactcttctggacaacaacatcgatccgcgtgaccaccccttcatc
attggagctaccaacctcaacgtggagacatacattgacgccactcgtgctggtcgtgag
ggcgactgggacaagcgcgcccacgccatgacgtacccggaagcggtccgtgaggctctg
aagaagtctggccgctcggatgccctggctaagtggaacgcccaatgcttggagctgagt
ctgcccaagttgcaggtgttggctaagtcactcggcgtcaacatcgcttttgactgggac
ctggctcgtacggtggaaggatactaccgcgtgcgtggcggtgtggagtactgcattgct
cgtggccgcgcgtacggcgagtacgccgacctgatctggatggagacggccaagccgggt
gtgccgcttgcgcgcacgttcgcggagggggtcaaggccaaaatcccgcaccagatgctg
gcgtacaacctgtcgccgtcgttcaactgggatgctgctggcatgtccgacacggagatt
gagacgttcgtgacggatcttggtcgtctgggcttctgctggatgttcattacgctagct
ggtttccacagtgactcgctgggcatcacgcgatttgcgcgcgactacgccaagcgcggc
atgctcgcgtacgtcgagggtgtgcagcgtgccgaacgcaacgaaggcgtggagacgctc
aagcaccagggctggtcgggcactgacctcgtggacgccatgcagaacaccattaccggt
gggctgtcgtcgacgaacacgatgggccacggtgtcacggaggcacagttctaa

DBGET integrated database retrieval system