KEGG   Phytophthora infestans: PITG_07145Help
Entry
PITG_07145        CDS       T01333                                 

Definition
malonyl-CoA decarboxylase (MCD), putative
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
pif  Phytophthora infestans
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PITG_07145
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PITG_07145
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    PITG_07145
Enzymes [BR:pif01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     PITG_07145
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 435 aa AA seqDB search
MHTDEKRQFLLILAQDLHIDTAVALQNAAQFEQNMVNVMDARGGIVNWEHENVERYLRTF
INLRNALSPLYEMFFQQILSQRENGMLFLVHMRADLLQVLRKSASHSEIPALRSFDASLK
QFLASWFSVGFLKLERVTYEHSPGQLLEKIIRYEAVHPVGTIAELKRRLGNGRRCFAFFH
PSIPDEPLVFVHVALMQEIASSMQSIRDETEQLADTSQANAAIFYSISSTQKGLAGVDLG
NFLIKEVAKALKTEHPRLKMFATLSPLPQFMPWLETQRYKTDESLVYPMELDALMDALEK
RSVAVPSNATPVAIVLDTLSIDKWSEDPELDAVLKPIMLKLGARYIYHEKKRGKALDPVT
NFHVRNGASFDRINWHADLSKKRLAQSAGMMINYKYELAHVETNNENYLLHNVIPIGLQP
QQVLKSTHHLTKKKE
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgcatactgacgagaagaggcagtttcttcttatcttggcacaggacttgcacattgac
acggctgtggctttgcaaaacgctgctcagttcgagcagaacatggtcaacgtgatggac
gcccgcggtggtatcgtgaactgggagcacgagaacgtggagagatacctgcgcacgttt
ataaatctccgtaacgcactctcgccgctctatgagatgttctttcaacaaattttgtca
cagcgagaaaacgggatgttgttcttagtacacatgagagcagacctgctgcaagtattg
cgtaagagcgcaagccattccgaaatccctgctcttcgctcatttgacgcaagcttaaaa
caatttttggcatcgtggtttagcgttggattcttgaagttagagcgtgtgacctacgag
cactctcctggccagcttctggagaaaatcattcgctacgaggcagtgcaccctgtgggc
acgattgccgaacttaagaggcggcttggaaatggacggcggtgctttgctttttttcac
cctagtattccagatgagcccttggtgtttgtgcatgtagcactgatgcaagagatcgca
tccagcatgcagtccattcgtgatgaaacggagcagctagcagacacctctcaagccaac
gctgctatcttttactctatctcttcgacgcaaaagggacttgcgggtgtcgacttgggt
aatttcctcattaaagaggtcgctaaagccctcaagacagagcacccgcgcttaaaaatg
ttcgcgactctgagcccattgccccaatttatgccatggctcgaaacgcagcggtataaa
acggatgaatcattggtttacccgatggagcttgatgctctgatggatgcgttagaaaag
cgtagcgtcgctgttccgtcaaacgcaactcccgtggccattgttttggacacgctgtcg
atcgataagtggagcgaagacccggagctggatgcagtacttaagcctatcatgttgaag
ctcggtgcacgctatatctaccatgaaaagaagcgcggaaaggcgttggaccccgtcacg
aacttccacgtcagaaatggtgccagttttgatcgaatcaactggcacgcagatctgtcc
aagaagagacttgcacaaagtgctggcatgatgattaactacaaatacgagttggcacac
gtggagacaaacaacgagaactacttactgcacaatgttatcccgattgggttacagccc
cagcaagtgcttaagagcacgcatcatttaaccaagaagaaggagtga

DBGET integrated database retrieval system