KEGG   Phytophthora infestans: PITG_07302Help
Entry
PITG_07302        CDS       T01333                                 

Definition
histone acetyltransferase, putative
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PITG_07302
Transcription factors [BR:pif03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    PITG_07302
Mitochondrial biogenesis [BR:pif03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    PITG_07302
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2294 aa AA seqDB search
MKKPRLVIPPALTLLMVLNAPAVNMVHPVIAAAPRSRGYTVTPNIAQGKEALNLNMDSSH
AFVGDFGMNMDAGDNRFMNQFNLGGGTNVNSSNMSGMDLSGGLDFSSGMNLMTDSSMMLG
GNSSTSTAGLIDFPDELNSPTTSSSGPSTSSLVMDTSVSMMSASSAPMSSTTDAIPFPAS
LASESLTNSGTSSSSSSGLDVMNFMNTTATSSAMNNNGNGMGLDMNMGMNMGMNMGVNMG
MNSMGMDMSGNNFGMNDTNNMMFNNMQHMNMMNQQGNYYMPQQQMQQQHYMQMMHQQRQL
NLQRQQQQQKALLERQRLAQQQQALKNNAHQQSQQQQQAAQQKQQQMLGTGQLPSQMAAQ
RQMSAGNSGLHATGNANAARSQPQASTQNNGSSTTATRPTWQSSADQALRKEMLNHIMRV
LQNQRSNAPANWLQKLPEMAHRLEDECYRIAASREEYANTSTLQSRLRSIVRSAQTHQRS
VGANAMRQPGTSTQASPANTRPATSTPAATPIPFPGLQAVASTPNGVSSDAKNLASQAIQ
MPPELQDPPSQLNTPVKADAAQAQALMQSTPSGIDSSLSDRLSMSGAGISPLAQNGVQTT
PGSTANTSGNATGSGPPTASSPASAARNKSAQIIWQFKAKAQQVTSALDKNQTTEYHNKL
RLMVRDDVKTAGSKEVLQRQQQRLLLLRHAMWCKSPESTCTTTPSCGEMKRLWAHMGACR
QTNACSYNHCISSKYVLSHFQQCVNAKCLVCQVVRYPVEVKEKNGALMLDADRALQQIIA
ASQRRQRMLAMKKQQEMQQQQMQQSQQPQQQMPLAMPAHLQQPQSNGNAAAMNFQQPQQS
VGQTVNHATPMGVNMNSMGMAMPNGGNRSVPMPIAQTNTQPAVTSNGMMGQQGNVKAENT
GAPMNLVPDDQRQFQLIKQKLNGRSLEQLTAHCVKLEKWVEEIRARMNGIMNECRQLLHL
SNSTQDPTQKTQYETQVQEKRVMLKQLDVKFKQCRSQRNIVKHVIDERNAASAMSTQNGV
NNAMSAMQPIPMPPQMQQQPSLQQPQLPSAPATPMKPSPDDLLGEEDDVAPKSDSSLAVA
GKPLEMPMDLQNTSATPVSVAAPLNMLTAPQQHTGNHSMAAMRPTLPMNHVQGKGYGQMQ
GQMLYNGGMGSGGMSSMPPTPGSFGDAVKVEPHVKPDTVGTASTQATPSAVKEEVAINPL
TMNNPKLNAMMSEHRRMDASTNLQLPAGAVGTPKAIIATSRGDATSSAAAAATPAPPASS
EVPMSVLNELSNEDLASHVDSLLTFYNATVSPANLKKKLEGTLRGMMEHKFGWVFNTPVD
PVALNIPNYFKIVRKPMDLGTVKKKLELGIYKHTEEFAYDVRTTFQNAMQYNSEDQDVYS
LAKDMLADFNSEMRKVVAEIDVDETAAREKESSCRLCGIERMVFEPAVLYCNGECNSRIR
RNCYYYTSADNKYHCCHQCHANLPDSIKHNEGRQYLKSELARKKNDEVHEEPWVQCDKCE
RWVHQICALFNGKIDSEKKPQLVKTEGGQSTDSGDASPSPSSSNAKSTTVTTTVVKSSSS
SSGSKGTVHSITISPGSEFLCPECLLEHRKSEPQKYKIGRHAFSAKDLQRTKLSDFLERR
LTKSLQAEREDEAKWTQRDVKDVETAEGLTVRLVSNIEKQLMVRDKMFQRYKDSHKYTSE
HRFKSKCICMFQEIDGVSVLLFGMYVHEFDEQEADCNSRRVYISYLDSVNYFKPAHLRTK
VYHELLIAYFDFVKQRGFHTAHLWACPPLKGDDYILYCHPEVQKTPKSDRLRAWYVDMLV
KAEEEGVVWQITNMYDDYWRNDNTPCALPYFEGDYWVGLVEDLIEKLDAEKPKKIVNKRG
SKSHKRKNSDTKKAANKKSKSKKPKRRKTASGGEASGDEDEDDDAHDGTTTSSRTLTVKS
LDTPDRKLSDPLMHKLGEVIEPMKDDFLVVKLVPCCRVCNTSVVQGVLWRDHSVQTEHGL
NPKVVQTALCDGCYQKLKAVSVAGSSTAHNRLQTRLNALTKENVAIPERCTDPDETNDSE
FFDTRQAFLSLCQGNHYQFDELRRAKHSSMMALYHLGNPNPNAYVYECNACTRDIVTGNR
WHCHTCPDFDVCDACYAKEKHEHPLEMVPTSGGGAAGTGAGGPAGAGGAAGTAALTAEQR
RLREQRAKNVRLHMQLLVHSSSCADGNCGSSNCEKMKELMRHGAQCKQRAYGGCTICRRV
WALLQLHARQCRQYECKVPRCHDLREHVRKLQLQQQLMDDRRRAAVTQQYRQMQNERQQE
QQSRAQGDEPMPQA
NT seq 6885 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaccgcgcctcgtcatcccgcccgcgttgactttgttgatggtgctcaatgct
ccagcagtaaacatggtccatccggtgatcgctgcagcaccgcgatcacgtggatacacc
gttacacccaacatagcacagggcaaggaggcacttaatcttaatatggactcctcacac
gcattcgtgggggacttcggcatgaacatggatgccggcgacaaccgctttatgaatcag
tttaacttgggcggtggtaccaacgtcaacagcagcaacatgagtggtatggacctgtcc
ggcggactggacttcagtagcggtatgaatctcatgacggactcgtccatgatgcttggt
ggcaactcgtcaacatccacagctgggctcatcgactttcccgacgagctcaactcgccc
acgacgtcaagcagtggcccgagtactagcagcttggtgatggacacatcagtgtcaatg
atgtccgcgtcgtcagcgccaatgagctccacgacggacgcgatcccatttccggcttca
ctagcatccgagtcgctgacgaacagcggcacgtcgtcctcgtcgtctagtggtctggac
gtgatgaactttatgaacacaaccgcgaccagtagcgccatgaacaacaatggcaacggg
atgggactggacatgaacatggggatgaacatgggtatgaatatgggcgtgaacatgggc
atgaacagcatggggatggacatgagcggcaacaatttcggtatgaacgacacgaacaac
atgatgttcaacaatatgcagcacatgaacatgatgaaccagcaggggaactactacatg
cctcagcagcaaatgcagcaacaacactacatgcagatgatgcaccagcagcgtcagcta
aacctgcagcgtcagcagcaacagcagaaagcgcttcttgagcgtcagcgactcgcgcag
cagcagcaggctctgaaaaataatgctcaccagcagagccaacagcagcaacaagcagca
cagcagaaacagcagcagatgctcggaacaggtcagctcccgtctcaaatggctgcccag
aggcagatgagtgcgggtaattcaggtctacacgctacaggtaatgcaaacgcagcacga
tcgcagcctcaagcttcgactcagaacaatggatcatcgacaactgcaacgcgaccgacg
tggcagtcttcagcggaccaggcgctgcgcaaggagatgctgaaccacattatgcgcgtg
cttcagaaccagcgatcgaatgctccagcaaattggctgcagaagctgccggagatggct
catcgtctggaagatgagtgctaccgtatcgctgcttcgcgtgaagagtatgcgaacaca
agcacactccagtctcgattgcggagcattgtgcgaagtgcgcagactcaccagcgaagt
gttggggccaatgcaatgaggcagccgggcacatcgactcaggcttctccagcgaatacc
cgaccagcgacgtccacgcctgctgcaacgcccatcccgtttcctggcttgcaagcagtt
gcatcgacgccgaacggggtcagttcggacgcaaaaaacctcgcttctcaagctattcaa
atgccgccggaactacaggacccgccgtctcaattgaacactccagtcaaggcagatgcg
gcgcaagctcaagctctcatgcagtcgacaccttcagggattgattcgtccttgtcggac
cggttgtcgatgagcggcgcaggtatctcgcctctagcccagaacggggttcaaacgacg
ccgggctctactgccaatacaagcgggaatgcaactggatcgggtcctccaacggccagc
tctcctgcctcggctgcgcgcaacaagtcggctcagatcatttggcagtttaaggcaaag
gctcagcaagtgacgtcagcgctggataagaaccagacaacggagtaccataacaagctg
cgcctcatggtccgtgatgacgtcaagaccgctggatcgaaggaagtgttgcagcgtcaa
caacagcgcctgttgctgctgcgtcatgccatgtggtgtaagtcgcctgagagcacatgc
acaacgacgccgagttgtggggagatgaagcgactctgggcgcatatgggtgcctgccga
cagactaacgcgtgctcgtacaaccactgtatctcgtccaagtacgtgctctcgcatttc
cagcagtgcgtgaacgctaagtgtctcgtgtgccaagttgttcgctaccccgtggaagtc
aaggagaaaaatggagcgctgatgctggatgcagaccgtgcgttacagcagattatcgct
gcgagtcagcgtcgtcagcgtatgctagcaatgaagaaacagcaggaaatgcagcagcag
cagatgcagcagtctcaacaaccgcagcagcagatgcctctggctatgcctgcgcatttg
cagcaacctcagagcaacggtaatgctgcggcgatgaacttccaacaacctcagcagagt
gttggacagacggtaaaccacgctactccgatgggtgttaatatgaactcgatggggatg
gcgatgccgaacggaggcaaccgctctgtaccgatgccgatagcacaaaccaacacgcag
cctgctgtgacttcgaacggtatgatgggccaacagggaaatgtcaaggcggagaatacg
ggtgcacctatgaatctggtaccagatgatcaacgacaattccagcttattaaacagaag
ctaaacggacgttcgctggagcagttgacggcgcattgcgtgaagctggagaagtgggtg
gaagagattcgagcgcgtatgaacggaattatgaacgagtgtcggcagctgctacacctc
tcgaactcgacacaagaccccacgcagaagacgcagtacgaaacgcaggtacaggagaaa
cgcgtgatgctcaagcaactggacgtcaagtttaagcaatgtagaagtcagcggaatatc
gtgaagcatgtgattgacgagcgcaacgctgcgtcggcgatgtcaacgcagaacggtgtg
aataacgccatgagtgcgatgcagccgattccgatgccaccccaaatgcaacagcaacct
tctctccaacagccgcagctaccgtcagctccagcgacgccgatgaagccatcgcctgat
gatttgttgggtgaagaggatgatgtagctcccaagagtgatagcagtcttgcagtggcg
ggaaagcctttggaaatgccgatggacctccaaaacacaagtgcgactcctgtctcggta
gctgcgccattgaacatgttgacagcgccgcagcaacacacaggcaaccactccatggca
gctatgcgaccaacgctgccgatgaatcatgtccaagggaaagggtacggtcaaatgcaa
gggcaaatgctgtacaatggggggatgggcagtgggggaatgagcagtatgccaccaact
ccagggtcgtttggagacgcggtgaaagtagaacctcacgtcaaacctgacactgtggga
acagcttcaactcaagccactccgtcggctgtaaaggaggaagtagccatcaacccactg
acgatgaacaatccgaagctgaacgcaatgatgtccgagcatcgtcggatggatgctagt
actaacttgcagcttccagccggtgctgtaggaacgccaaaggcgatcatagcgaccagt
agaggtgatgcgacctcaagtgctgcagcggcagcaacaccagcgccgcctgcttcctct
gaagtgccaatgtctgtgctgaacgaactcagtaacgaggatctagcttctcatgtggac
tctttgttaacgttctacaacgccacagtgtcccctgcgaatctgaagaagaaattggaa
ggaactctaagaggaatgatggagcacaagtttggctgggtgttcaacacgcccgtggac
ccggtggcgctgaatatcccgaactactttaagattgtccggaagccgatggacttaggg
actgtgaaaaagaaactggaacttgggatttacaagcacacggaggagttcgcgtatgac
gtccgaacgacgttccagaatgcaatgcagtacaacagcgaagaccaggatgtctacagt
ctcgcgaaggacatgctagcggactttaacagtgaaatgcgcaaggttgtagccgaaatc
gatgtcgacgagacggctgctcgtgagaaggagagctcttgtcgactctgcggcattgag
cgcatggtatttgagcctgctgtgctgtactgcaacggcgagtgtaacagtcgtatccga
cggaactgctactactacacgtcagcggataacaaatatcactgctgtcatcaatgccac
gctaatctgcctgattccatcaagcacaacgaaggacgccagtatctgaagagtgagctc
gcgcggaaaaagaacgacgaagtgcacgaagagccatgggtgcagtgtgacaaatgcgag
cgttgggttcaccagatctgcgcgcttttcaatggaaagattgacagtgagaagaagccg
cagttggtcaagaccgagggaggtcagtcaactgacagcggcgatgcttctccgtcgcct
tcgtcgtcgaatgcaaagtctacgactgtcactacgacagttgtcaagagttcttcttcg
tcatcgggatcgaaagggacggtccactccatcacgatctcgcccggcagcgagtttcta
tgccccgagtgcttactggagcaccgcaagagtgaacctcagaagtacaagatcgggcgc
cacgccttcagtgcgaaggatctgcagcgcacgaagctgtcagattttctggagcgtcgt
ctaaccaagtcattgcaagcagagcgtgaggatgaggccaaatggacgcaacgcgacgtg
aaagatgtggagacggcggaaggtctgactgtgcgtttggtgtcgaacattgagaagcag
ctgatggtgcgcgataaaatgttccagcggtacaaggactcgcacaagtacacgtccgag
catcggttcaagtccaagtgcatttgtatgttccaggagattgatggtgtgtcggtgttg
ctgttcggtatgtacgtacacgagttcgacgagcaagaagcggattgcaactcgcgtcgc
gtatacatctcgtatctggactcggtgaactacttcaagccggctcatctgcgcaccaag
gtgtatcacgaactgttgattgcgtactttgactttgtcaagcagcgtggcttccacacg
gcgcatctgtgggcttgtccacctctgaagggcgatgactatatcttgtactgccatccc
gaggtacagaagacgcccaagtcggatcgtctacgcgcttggtatgtggatatgctggtc
aaggctgaggaagagggggtagtatggcagatcaccaatatgtacgatgactattggcgc
aatgataacacgccgtgtgctctgccgtacttcgagggcgactattgggtcggcctggtc
gaagacttgatcgagaagttggacgccgagaagccgaaaaagattgtcaataaacgtggc
tccaagtcgcacaagcgcaagaactcggatacgaagaaagcggcgaacaagaagtcgaaa
tcgaagaagccaaagcgccggaagacagcgtctggtggcgaggcgtcaggagatgaggac
gaagacgacgatgcacatgatggtactacgacgagtagccgcacgcttacagtgaagtcg
ttggatactccagaccggaagctgtcggaccctttaatgcacaaactcggtgaagtgatc
gagcccatgaaggacgacttcttggtggtgaagctggtaccatgttgtcgtgtgtgcaac
acgtctgtggtgcaaggcgtgctttggcgcgaccacagtgtgcaaacagagcacggtctt
aatccgaaggtggtgcaaactgccttgtgcgatggatgctaccagaagctcaaggctgta
tcggttgcaggttcatctacagcccacaacaggctccagacgcggctgaacgcattgaca
aaggagaatgtagcaataccagaacgctgcacggacccggatgagaccaacgacagcgag
tttttcgacacccgtcaagcatttttgagcctgtgtcaaggcaaccactaccagttcgac
gagctgcggcgagcgaaacactcgtctatgatggcgttgtaccacttgggcaacccgaac
ccgaacgcctacgtgtacgagtgcaacgcgtgcacgcgcgacatcgtgacgggcaaccgc
tggcattgccacacgtgtccggactttgacgtgtgcgacgcttgttacgccaaggagaag
cacgaacatccactggaaatggtgccgacaagtggcggaggagccgctggaactggtgct
ggtggtcctgctggagccggaggcgcagctggcactgcagctctgactgcagagcagcgc
cgtcttcgcgaacagcgcgccaagaacgttcgtctgcacatgcagctgctagtgcactcg
agttcgtgtgcagacggcaactgtggctcgtccaactgcgagaagatgaaggagctgatg
cgtcacggcgcgcagtgcaagcagcgagcgtacggcggctgcacgatctgtcggcgtgtg
tgggcgctactgcagctccacgctcggcagtgtcgccaatatgagtgcaaggtgccgcgc
tgtcacgacctgcgggagcatgtgcgcaagctgcagttacagcagcaactcatggacgac
cgtcgtcgcgctgctgtcacgcaacagtatcgccagatgcagaacgagcgacaacaggaa
caacagagccgagctcaaggcgacgagcccatgccacaggcatga

DBGET integrated database retrieval system