KEGG   Phytophthora infestans: PITG_07400Help
Entry
PITG_07400        CDS       T01333                                 

Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pif  Phytophthora infestans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:pif01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pif01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pif00010]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pif00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 260 aa AA seqDB search
MAAKYQIVLIRHGESQWNVDNRFTGWHDVQLSAKGEQESHDAGKVLKEAGFKFDLAYTSV
LKRAIKTLWNILEETDLMWIPVTRSWRLNERHYGALTGLNKQETVDKHGIEKVMIWRRSY
ATPPPSLEADSEFYPGNDAKYADVPKELLPFAESLATTGERVLPYWEQTIIPSIKEGKKI
VIAAHGNSLRALVKHLDNIPEDTITGLNIPTGVPLVYDLDENFKPIPHKDAIGLLSGYYV
GNQEEIKARIAGVANQTKAK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaagtatcaaatcgttctcatccgccacggcgagagtcagtggaatgtggac
aatcgcttcacgggctggcacgacgtgcagctgtctgccaagggcgaacaggagtcgcac
gatgccggcaaagtgctgaaggaggcaggatttaagttcgatctggcctacacgtcggtg
ctcaagcgtgccattaagacgctgtggaacatcctggaggagacggacctcatgtggatc
cccgttacccgctcgtggcgccttaacgagcgtcactacggtgcgctcacgggcctcaac
aagcaggagactgtggacaagcacggcattgagaaggtgatgatctggcgtcgtagttac
gccacacctcccccttcgctcgaggctgatagcgagttttacccgggcaacgatgcgaag
tacgcggatgtgcctaaggagcttcttcccttcgctgagtcgcttgccactaccggtgag
cgtgtgttgccctactgggaacagaccatcattccttctatcaaggaaggcaaaaagatt
gtgattgccgctcacggcaactcgctccgtgcgctggttaagcacctggacaacatcccg
gaggacacgatcacgggtcttaacatccccacgggagttcctcttgtgtacgacctggac
gagaacttcaagcccatcccgcacaaggacgccattggtcttctgtcgggctactacgtc
gggaaccaggaggagattaaggcgcgtattgctggtgttgccaaccagaccaaggccaag
taa

DBGET integrated database retrieval system